SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|510880612|ref|YP_008053280.1| from Salinarchaeum sp. Harcht-Bsk1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|510880612|ref|YP_008053280.1|
Domain Number 1 Region: 245-499
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 4.32e-53
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000254
Further Details:      
 
Domain Number 2 Region: 15-201
Classification Level Classification E-value
Superfamily Globin-like 4.82e-28
Family Globins 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|510880612|ref|YP_008053280.1|
Sequence length 503
Comment methyl-accepting chemotaxis protein [Salinarchaeum sp. Harcht-Bsk1]
Sequence
MSTDSGFKITDDDRKAVDGTRLSDDIGIDEQEIRWRKEFTRFDSSDVDALEGMSDTFDRI
AEDLVDEFYEHLQANNDAIAILESSSKPVEALKRSQEQYLVDLGSGGYDQSYFDRRARIG
KIHDMLDLGPKFYLGAYSIYYEGVLDAIGSDVIESVRDGSLDGVDDDGSADEDAVQAAVD
EVTERSLSVLKLLLLDQQVAMDTYIHSYSQQVEEELDRQRRVGQEVEDSARELEQASTDV
AESADEITDAAEDQVSRCTEVSEEVSALGATVEEIAATADQVEAEASEAKEYAEAGQRSA
DDAIEQMEVVDDAADDVTEDFESLSERLAEIDDVVDVIHQISEETHLLALNASIEAARAG
GEAAGFAVVAEEVKQLAEDAQEQADEIEQLVETIQTHRERALESLDETNEALVGGIDAVQ
DVDEQLDSIVQSVGEAADGITEVAVATDEQAASTEEVATMVDELADGAHDVADEIEDVAA
ATEEQTATISEVRTTASELTGSE
Download sequence
Identical sequences R4W3E5
WP_020445376.1.31664 gi|510880612|ref|YP_008053280.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]