SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|510880682|ref|YP_008053350.1| from Salinarchaeum sp. Harcht-Bsk1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|510880682|ref|YP_008053350.1|
Domain Number 1 Region: 275-531
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 1.57e-38
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000985
Further Details:      
 
Domain Number 2 Region: 15-161
Classification Level Classification E-value
Superfamily Globin-like 3.67e-30
Family Globins 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|510880682|ref|YP_008053350.1|
Sequence length 546
Comment chemotaxis sensory transducer [Salinarchaeum sp. Harcht-Bsk1]
Sequence
MNPEEVFGRGGLNANVDADQLTDDIGLDRDEIAWRKEFIGFDAEDERRLASMEPLLREHR
EEIAERFYENLTQYEQTTDVIGRSEKSVEQLKQTQQAYMVTLATGEYDEAYFRNRARIGK
LHELLDMPLKHYIGQYGVYYDLLFERLDDRIQNQVVAAIEDWAVERAEAERSDGLFGSVL
GALGDDADDPGDLDEDFESTVRDAIHDGVADLLALLRIINLDVQVACDTYVDSYSNRLEA
EIQRRQRLASEVETDVQEPIGDLHDAAGTVAEGAETIHELTTDQSQGVRTAAEEAEDLSA
TVEEIAGTAGNVRTLGERTEEVASEGVAEAEETVAAMDDLREETQAAVAATERLEQQADR
IDDVVETIEEVTNQTKILAANARVEASRSDASSEALDVLGEEVRSFAEETSEQLQALPET
VEELRGIAREVSDAIDAAAAQLEDSSEQVESLGERLDTVHGAADETADGMAEIEQATEQQ
ARSAEAIAAEMDGLADAADRVASETESLAASAEEQTAALGDVAESVERLTDTSDLASNAE
ERRPAR
Download sequence
Identical sequences R4W3I5
WP_020445446.1.31664 gi|510880682|ref|YP_008053350.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]