SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|510881756|ref|YP_008054424.1| from Salinarchaeum sp. Harcht-Bsk1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|510881756|ref|YP_008054424.1|
Domain Number 1 Region: 4-87
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.69e-33
Family Imidazole glycerol phosphate dehydratase 0.00016
Further Details:      
 
Domain Number 2 Region: 90-179
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.05e-26
Family Imidazole glycerol phosphate dehydratase 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|510881756|ref|YP_008054424.1|
Sequence length 195
Comment imidazoleglycerol-phosphate dehydratase [Salinarchaeum sp. Harcht-Bsk1]
Sequence
MSDRAAAVSRETAETDIDLTLEIDGDGEAEVDTGIGFFDHMLEALATHGLFDLTVSCDGD
LEVDDHHTVEDVGIALGEAFDEALGERERIVRYADRRVPLDESVASVVVDVSGRPRFYFE
GTFSQAAVGELASDMARHFFESLALNAGLTLHAEIEGRNAHHEIEALFKAVAGAMDDATR
IDERRSGAPSTKGEL
Download sequence
Identical sequences R4VZE4
WP_020446520.1.31664 gi|510881756|ref|YP_008054424.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]