SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|510882537|ref|YP_008055205.1| from Salinarchaeum sp. Harcht-Bsk1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|510882537|ref|YP_008055205.1|
Domain Number 1 Region: 178-321
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 8.63e-33
Family Mevalonate 5-diphosphate decarboxylase 0.076
Further Details:      
 
Domain Number 2 Region: 1-167
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.75e-31
Family GHMP Kinase, N-terminal domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|510882537|ref|YP_008055205.1|
Sequence length 328
Comment diphosphomevalonate decarboxylase [Salinarchaeum sp. Harcht-Bsk1]
Sequence
MKATAIAHPIQGIVKYHGMRDAQQRLPYHDSISVCTAPSHSKTTVEFSMDNEDNTYLIDG
EEVEGSARDRLDRIVEEVRERSDAPHAVYGVRMESENSFPTNVGLGSSSSGFAAIATALA
EAAELDATLGELSAIARRGSASAARSVTGGYSHLRAGLNDQDCRSHRIDSEIAEDHKIVV
GLVPSYKDTDDAHEEAVESHMFQARMAHIHEQIAECRDALRKDDFDRVFELAEHDSLSLA
ATTMTGPEGWVYWSPKTLQIFAAVRELREEDDIPVYFSTDTGASVYVNTTEEHVDEVEEA
VADCGVQTAVWEVGGPARILKEEEQALF
Download sequence
Identical sequences R4W6M1
gi|510882537|ref|YP_008055205.1| WP_020447301.1.31664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]