SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384120647|ref|YP_005503267.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384120647|ref|YP_005503267.1|
Domain Number 1 Region: 9-401
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.64e-127
Family GABA-aminotransferase-like 0.0000000000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384120647|ref|YP_005503267.1|
Sequence length 403
Comment 2-amino-3-ketobutyrate coenzyme A ligase [Yersinia pestis D106004]
Sequence
MSLPCNKHPFYQQLEQQLDTTRTEGLYKNERVITSAQQANIAVADGSRVINFCANNYLGL
ANHPKLIAAAKAGMDSHGFGMASVRFICGTQDIHKELEHKLASFLGMEDAILYSSCFDAN
GGLFETLLGPEDAIISDALNHASIIDGVRLCKAKRYRYANNDMTELEAQLKQAKAEGARH
IMIATDGVFSMDGVIANLKRVCDLADEYQALVMVDDSHAVGVIGANGRGTHEYCEVMDRV
DIITGTLGKALGGASGGYTAGRKELVEWLRQRSRPYLFSNSLAPAIVAASIEVLSLLEEG
GALRDRLWANARLFREKMSAAGFTLAGADHAIIPVMLGEAKLAQDFANALLKEGIYVTGF
FFPVVPKGQARIRTQMSAGHTTEQVERAIEAFVRIGKQLNVIA
Download sequence
Identical sequences A0A0E1NW09 A0A0H2YM65 A0A0H3B7V3 A0A0M1VCP4 A0A0U1EU39 A0A208S6J5 A0A2A7VL33 Q0WKN3 Q66GC6
gi|161484922|ref|NP_667424.2| gi|384137957|ref|YP_005520659.1| 187410.y0081 214092.YPO0059 273123.YPTB0056 360102.YPA_3483 377628.YPN_3791 502800.YPK_4145 502801.YPTS_0058 gi|108813951|ref|YP_649718.1| gi|51594414|ref|YP_068605.1| WP_002208982.1.100083 WP_002208982.1.100246 WP_002208982.1.100593 WP_002208982.1.10066 WP_002208982.1.100921 WP_002208982.1.100931 WP_002208982.1.10105 WP_002208982.1.101305 WP_002208982.1.101382 WP_002208982.1.101928 WP_002208982.1.102012 WP_002208982.1.102067 WP_002208982.1.10736 WP_002208982.1.10935 WP_002208982.1.10955 WP_002208982.1.11693 WP_002208982.1.12463 WP_002208982.1.12736 WP_002208982.1.12857 WP_002208982.1.14063 WP_002208982.1.14804 WP_002208982.1.15321 WP_002208982.1.15555 WP_002208982.1.15605 WP_002208982.1.15689 WP_002208982.1.16333 WP_002208982.1.17135 WP_002208982.1.17141 WP_002208982.1.17873 WP_002208982.1.17983 WP_002208982.1.18208 WP_002208982.1.18640 WP_002208982.1.18826 WP_002208982.1.19329 WP_002208982.1.19425 WP_002208982.1.19739 WP_002208982.1.19763 WP_002208982.1.20035 WP_002208982.1.20380 WP_002208982.1.20547 WP_002208982.1.2064 WP_002208982.1.20932 WP_002208982.1.21486 WP_002208982.1.21784 WP_002208982.1.21879 WP_002208982.1.21934 WP_002208982.1.22530 WP_002208982.1.22542 WP_002208982.1.22708 WP_002208982.1.23157 WP_002208982.1.23271 WP_002208982.1.23811 WP_002208982.1.24002 WP_002208982.1.2451 WP_002208982.1.24517 WP_002208982.1.25394 WP_002208982.1.26383 WP_002208982.1.2640 WP_002208982.1.26776 WP_002208982.1.26960 WP_002208982.1.27251 WP_002208982.1.2726 WP_002208982.1.28922 WP_002208982.1.29157 WP_002208982.1.29186 WP_002208982.1.29355 WP_002208982.1.2947 WP_002208982.1.2964 WP_002208982.1.29814 WP_002208982.1.3092 WP_002208982.1.30931 WP_002208982.1.311 WP_002208982.1.31336 WP_002208982.1.31496 WP_002208982.1.31721 WP_002208982.1.31739 WP_002208982.1.31805 WP_002208982.1.32343 WP_002208982.1.32388 WP_002208982.1.32446 WP_002208982.1.32736 WP_002208982.1.33203 WP_002208982.1.33324 WP_002208982.1.33775 WP_002208982.1.33937 WP_002208982.1.34031 WP_002208982.1.34138 WP_002208982.1.35389 WP_002208982.1.35538 WP_002208982.1.36088 WP_002208982.1.37174 WP_002208982.1.37863 WP_002208982.1.38147 WP_002208982.1.38235 WP_002208982.1.38532 WP_002208982.1.38743 WP_002208982.1.38824 WP_002208982.1.38993 WP_002208982.1.39066 WP_002208982.1.39346 WP_002208982.1.39858 WP_002208982.1.40071 WP_002208982.1.40134 WP_002208982.1.40534 WP_002208982.1.40853 WP_002208982.1.41196 WP_002208982.1.4210 WP_002208982.1.42361 WP_002208982.1.42490 WP_002208982.1.42976 WP_002208982.1.44598 WP_002208982.1.44603 WP_002208982.1.44832 WP_002208982.1.45198 WP_002208982.1.45214 WP_002208982.1.46262 WP_002208982.1.46545 WP_002208982.1.46686 WP_002208982.1.46697 WP_002208982.1.4678 WP_002208982.1.46891 WP_002208982.1.47387 WP_002208982.1.47440 WP_002208982.1.47769 WP_002208982.1.47881 WP_002208982.1.48166 WP_002208982.1.48722 WP_002208982.1.49315 WP_002208982.1.49906 WP_002208982.1.4997 WP_002208982.1.50010 WP_002208982.1.50093 WP_002208982.1.50106 WP_002208982.1.50185 WP_002208982.1.50984 WP_002208982.1.51284 WP_002208982.1.51293 WP_002208982.1.51588 WP_002208982.1.51772 WP_002208982.1.51934 WP_002208982.1.52158 WP_002208982.1.52247 WP_002208982.1.52734 WP_002208982.1.52792 WP_002208982.1.52819 WP_002208982.1.52969 WP_002208982.1.53147 WP_002208982.1.53300 WP_002208982.1.53838 WP_002208982.1.53848 WP_002208982.1.53883 WP_002208982.1.53953 WP_002208982.1.54568 WP_002208982.1.54951 WP_002208982.1.55194 WP_002208982.1.55695 WP_002208982.1.5592 WP_002208982.1.56912 WP_002208982.1.56953 WP_002208982.1.57585 WP_002208982.1.57657 WP_002208982.1.58067 WP_002208982.1.58794 WP_002208982.1.59102 WP_002208982.1.59431 WP_002208982.1.5957 WP_002208982.1.59635 WP_002208982.1.5968 WP_002208982.1.59687 WP_002208982.1.59789 WP_002208982.1.59885 WP_002208982.1.60437 WP_002208982.1.61689 WP_002208982.1.62232 WP_002208982.1.62342 WP_002208982.1.6270 WP_002208982.1.63387 WP_002208982.1.63641 WP_002208982.1.64142 WP_002208982.1.64474 WP_002208982.1.64780 WP_002208982.1.64786 WP_002208982.1.64910 WP_002208982.1.653 WP_002208982.1.65400 WP_002208982.1.65554 WP_002208982.1.6570 WP_002208982.1.65706 WP_002208982.1.65718 WP_002208982.1.6581 WP_002208982.1.66118 WP_002208982.1.66546 WP_002208982.1.66616 WP_002208982.1.67404 WP_002208982.1.67850 WP_002208982.1.6791 WP_002208982.1.68361 WP_002208982.1.68371 WP_002208982.1.68753 WP_002208982.1.69018 WP_002208982.1.69316 WP_002208982.1.69951 WP_002208982.1.70117 WP_002208982.1.70171 WP_002208982.1.70319 WP_002208982.1.70377 WP_002208982.1.70417 WP_002208982.1.70726 WP_002208982.1.7083 WP_002208982.1.7169 WP_002208982.1.71744 WP_002208982.1.72280 WP_002208982.1.72440 WP_002208982.1.7402 WP_002208982.1.74310 WP_002208982.1.74577 WP_002208982.1.74738 WP_002208982.1.75169 WP_002208982.1.75173 WP_002208982.1.7518 WP_002208982.1.75208 WP_002208982.1.75337 WP_002208982.1.75407 WP_002208982.1.75689 WP_002208982.1.75821 WP_002208982.1.76555 WP_002208982.1.76670 WP_002208982.1.77295 WP_002208982.1.77387 WP_002208982.1.77429 WP_002208982.1.77569 WP_002208982.1.77691 WP_002208982.1.78004 WP_002208982.1.7841 WP_002208982.1.78556 WP_002208982.1.79515 WP_002208982.1.79550 WP_002208982.1.79609 WP_002208982.1.79825 WP_002208982.1.79981 WP_002208982.1.80331 WP_002208982.1.81848 WP_002208982.1.81877 WP_002208982.1.8210 WP_002208982.1.82133 WP_002208982.1.82151 WP_002208982.1.82270 WP_002208982.1.82436 WP_002208982.1.8303 WP_002208982.1.83039 WP_002208982.1.83265 WP_002208982.1.8420 WP_002208982.1.84703 WP_002208982.1.84720 WP_002208982.1.85269 WP_002208982.1.85270 WP_002208982.1.8559 WP_002208982.1.85802 WP_002208982.1.86034 WP_002208982.1.86059 WP_002208982.1.86413 WP_002208982.1.87107 WP_002208982.1.8728 WP_002208982.1.87418 WP_002208982.1.87853 WP_002208982.1.87988 WP_002208982.1.88362 WP_002208982.1.88472 WP_002208982.1.89359 WP_002208982.1.8964 WP_002208982.1.90176 WP_002208982.1.9051 WP_002208982.1.91844 WP_002208982.1.92331 WP_002208982.1.92604 WP_002208982.1.927 WP_002208982.1.9311 WP_002208982.1.9320 WP_002208982.1.93623 WP_002208982.1.93928 WP_002208982.1.93933 WP_002208982.1.94052 WP_002208982.1.94201 WP_002208982.1.94545 WP_002208982.1.94683 WP_002208982.1.95746 WP_002208982.1.95981 WP_002208982.1.97245 WP_002208982.1.97375 WP_002208982.1.97448 WP_002208982.1.97791 WP_002208982.1.97864 WP_002208982.1.97872 WP_002208982.1.97894 WP_002208982.1.99109 WP_002208982.1.99383 WP_002208982.1.9941 WP_002208982.1.99416 WP_002208982.1.99788 WP_002208982.1.99882 WP_002208982.1.99972 WP_002208982.1.99990 YP_002345155.1.25044 gi|186893402|ref|YP_001870514.1| gi|108809474|ref|YP_653390.1| gi|170026352|ref|YP_001722857.1| gi|218927280|ref|YP_002345155.1| gi|384412909|ref|YP_005622271.1| gi|384120647|ref|YP_005503267.1| IDP00580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]