SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384120743|ref|YP_005503363.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384120743|ref|YP_005503363.1|
Domain Number 1 Region: 17-399
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.44e-128
Family GABA-aminotransferase-like 0.000000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384120743|ref|YP_005503363.1|
Sequence length 405
Comment hypothetical protein YPD4_0151 [Yersinia pestis D106004]
Sequence
MTDKLAVNRNTFDQVILPVYAPAQFIPVKGKGSRVWDQQGTEYIDFAGGIAVTALGHCHP
ALVSALHQQGETLWHTSNVFTNEPALRLAQKLIAATFADRVFFANSGAEANEAAFKLARH
YAIERHSPYKTKIIAFHNAFHGRTLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLAAVKA
VMDDHTCAVVLEPIQGEGGITSATPEFLQGVRALCDQHNALLVFDEVQSGMGRSGKLFSY
MHYGVTPDILTTAKALGGGFPISAMLTTEEIASVMTVGTHGTTYGGNPLACAVAEAALDV
INTPEVLNGIEQRHGLFVQALQSINSKYDVFSDIRGMGLLIGAELTAKYRGQAREFLAAA
AANGLMILNAGPDVLRLAPSLVIELEDIQQGMARLEKAMASVIKG
Download sequence
Identical sequences A0A0E1NV29 A0A0H2YNT7 A0A0H3AZS3 A0A0M1V1X5 A0A154SDH6 A0A208S9C2 A0A2A7VM22 P59324
gi|108814054|ref|YP_649821.1| gi|170022506|ref|YP_001719011.1| gi|384120743|ref|YP_005503363.1| gi|384137848|ref|YP_005520550.1| WP_002212295.1.100246 WP_002212295.1.10066 WP_002212295.1.100921 WP_002212295.1.100931 WP_002212295.1.101382 WP_002212295.1.102012 WP_002212295.1.102067 WP_002212295.1.10955 WP_002212295.1.11693 WP_002212295.1.12736 WP_002212295.1.12857 WP_002212295.1.1388 WP_002212295.1.14804 WP_002212295.1.15321 WP_002212295.1.15605 WP_002212295.1.15689 WP_002212295.1.16243 WP_002212295.1.16333 WP_002212295.1.17608 WP_002212295.1.17983 WP_002212295.1.18826 WP_002212295.1.19329 WP_002212295.1.19425 WP_002212295.1.20035 WP_002212295.1.20380 WP_002212295.1.20547 WP_002212295.1.2064 WP_002212295.1.21879 WP_002212295.1.21934 WP_002212295.1.22530 WP_002212295.1.22542 WP_002212295.1.22708 WP_002212295.1.23157 WP_002212295.1.23687 WP_002212295.1.23811 WP_002212295.1.24002 WP_002212295.1.2451 WP_002212295.1.24517 WP_002212295.1.25181 WP_002212295.1.25394 WP_002212295.1.26776 WP_002212295.1.27124 WP_002212295.1.27251 WP_002212295.1.28647 WP_002212295.1.28922 WP_002212295.1.29157 WP_002212295.1.29355 WP_002212295.1.2947 WP_002212295.1.29622 WP_002212295.1.29685 WP_002212295.1.29814 WP_002212295.1.3092 WP_002212295.1.311 WP_002212295.1.31336 WP_002212295.1.31496 WP_002212295.1.31739 WP_002212295.1.31805 WP_002212295.1.32388 WP_002212295.1.32446 WP_002212295.1.33661 WP_002212295.1.33937 WP_002212295.1.34031 WP_002212295.1.35389 WP_002212295.1.36088 WP_002212295.1.37174 WP_002212295.1.37494 WP_002212295.1.38147 WP_002212295.1.38532 WP_002212295.1.38743 WP_002212295.1.38824 WP_002212295.1.38993 WP_002212295.1.39346 WP_002212295.1.3976 WP_002212295.1.39858 WP_002212295.1.40534 WP_002212295.1.40853 WP_002212295.1.41196 WP_002212295.1.4210 WP_002212295.1.42361 WP_002212295.1.42490 WP_002212295.1.42976 WP_002212295.1.44408 WP_002212295.1.44598 WP_002212295.1.44603 WP_002212295.1.44832 WP_002212295.1.45198 WP_002212295.1.45214 WP_002212295.1.46262 WP_002212295.1.46731 WP_002212295.1.4678 WP_002212295.1.46891 WP_002212295.1.47387 WP_002212295.1.47769 WP_002212295.1.47881 WP_002212295.1.48166 WP_002212295.1.4889 WP_002212295.1.49315 WP_002212295.1.49906 WP_002212295.1.50106 WP_002212295.1.50984 WP_002212295.1.51284 WP_002212295.1.51934 WP_002212295.1.52158 WP_002212295.1.52247 WP_002212295.1.52734 WP_002212295.1.52792 WP_002212295.1.52969 WP_002212295.1.53147 WP_002212295.1.53300 WP_002212295.1.53848 WP_002212295.1.54568 WP_002212295.1.55695 WP_002212295.1.5592 WP_002212295.1.56031 WP_002212295.1.56912 WP_002212295.1.56953 WP_002212295.1.57585 WP_002212295.1.57657 WP_002212295.1.58794 WP_002212295.1.59431 WP_002212295.1.59687 WP_002212295.1.59789 WP_002212295.1.60437 WP_002212295.1.60707 WP_002212295.1.60896 WP_002212295.1.61689 WP_002212295.1.62232 WP_002212295.1.6270 WP_002212295.1.63387 WP_002212295.1.64474 WP_002212295.1.64780 WP_002212295.1.653 WP_002212295.1.65400 WP_002212295.1.65554 WP_002212295.1.65706 WP_002212295.1.65718 WP_002212295.1.6581 WP_002212295.1.66118 WP_002212295.1.66546 WP_002212295.1.67404 WP_002212295.1.68371 WP_002212295.1.68753 WP_002212295.1.68855 WP_002212295.1.69316 WP_002212295.1.69951 WP_002212295.1.70377 WP_002212295.1.70417 WP_002212295.1.70726 WP_002212295.1.7083 WP_002212295.1.7169 WP_002212295.1.72280 WP_002212295.1.72440 WP_002212295.1.72486 WP_002212295.1.75173 WP_002212295.1.7518 WP_002212295.1.75407 WP_002212295.1.75636 WP_002212295.1.75821 WP_002212295.1.76555 WP_002212295.1.77387 WP_002212295.1.77429 WP_002212295.1.77691 WP_002212295.1.78004 WP_002212295.1.7841 WP_002212295.1.79515 WP_002212295.1.79550 WP_002212295.1.79609 WP_002212295.1.8009 WP_002212295.1.8210 WP_002212295.1.82133 WP_002212295.1.82270 WP_002212295.1.82436 WP_002212295.1.8303 WP_002212295.1.83265 WP_002212295.1.83630 WP_002212295.1.84703 WP_002212295.1.85269 WP_002212295.1.85270 WP_002212295.1.85802 WP_002212295.1.86059 WP_002212295.1.86413 WP_002212295.1.8728 WP_002212295.1.8762 WP_002212295.1.87853 WP_002212295.1.87988 WP_002212295.1.88362 WP_002212295.1.88472 WP_002212295.1.8964 WP_002212295.1.90176 WP_002212295.1.9051 WP_002212295.1.90624 WP_002212295.1.91844 WP_002212295.1.92030 WP_002212295.1.92331 WP_002212295.1.92604 WP_002212295.1.927 WP_002212295.1.9311 WP_002212295.1.93623 WP_002212295.1.93928 WP_002212295.1.93933 WP_002212295.1.94052 WP_002212295.1.94545 WP_002212295.1.95746 WP_002212295.1.95981 WP_002212295.1.97245 WP_002212295.1.97375 WP_002212295.1.97864 WP_002212295.1.97872 WP_002212295.1.99109 WP_002212295.1.99383 WP_002212295.1.9941 WP_002212295.1.99416 WP_002212295.1.99788 WP_002212295.1.99882 WP_002212295.1.99990 gi|162419307|ref|YP_001608023.1| 349746.YpAngola_A3704 360102.YPA_3299 377628.YPN_3894 386656.YPDSF_0098 502800.YPK_0245 gi|145597419|ref|YP_001161494.1| gi|384412802|ref|YP_005622164.1| gi|108809290|ref|YP_653206.1| gi|384124626|ref|YP_005507240.1| gi|294502259|ref|YP_003566321.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]