SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384120874|ref|YP_005503494.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384120874|ref|YP_005503494.1|
Domain Number 1 Region: 1-389
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.12e-115
Family AAT-like 0.0000000000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384120874|ref|YP_005503494.1|
Sequence length 397
Comment aspartate aminotransferase [Yersinia pestis D106004]
Sequence
MFQNVDAYAGDPILSLMESFKADNRAHKVNLSIGLYYNEQGEIPQMQAVDAAEAQLSTQP
HGTPVYLPMEGLQSYRTAIQQLLFGHDHPMLVQQRVATIQTVGGSGALKVGADFLNHYFP
DSQVWVSDPTWENHVAIFSGAGFKVNTYPYFDNDKLAVKFDPMLATLQQLPARSIVLLHP
CCHNPTGSDLTNAQWDRLIDVVKERELIPFLDIAYQGFGAGLNEDAYAIRAMAAVGLPCL
ISNSFSKIFSLYNERVGGLSVVCESDEAAGRVLGQLKATVRRNYSSPPNFGAQVVSKVLN
DTVLRAQWQAEVEQMRLRILDMRHTLVEALKASLPERNFDYLLQQRGMFSYTGFSEAQVE
SLREEFGVYLIASGRMCMAGVNHQNVEQVAVAFAAVQ
Download sequence
Identical sequences A0A0E1NQ54 A0A0H2W2H9 A0A0H2YKX6 A0A0M1VC56 A0A208S8M5 Q7CKP1
187410.y0579 214092.YPO0322 229193.YP_0477 349746.YpAngola_A0753 360102.YPA_3963 377628.YPN_3348 386656.YPDSF_3650 gi|218927527|ref|YP_002345402.1| gi|384413310|ref|YP_005622672.1| gi|294502387|ref|YP_003566449.1| IDP04704 gi|384124752|ref|YP_005507366.1| gi|108809953|ref|YP_653869.1| gi|108813508|ref|YP_649275.1| gi|22124493|ref|NP_667916.1| WP_002209097.1.100083 WP_002209097.1.100246 WP_002209097.1.100921 WP_002209097.1.100931 WP_002209097.1.101382 WP_002209097.1.102012 WP_002209097.1.102067 WP_002209097.1.10736 WP_002209097.1.10935 WP_002209097.1.10955 WP_002209097.1.11693 WP_002209097.1.12736 WP_002209097.1.12857 WP_002209097.1.1388 WP_002209097.1.15321 WP_002209097.1.15555 WP_002209097.1.15689 WP_002209097.1.16243 WP_002209097.1.16333 WP_002209097.1.17135 WP_002209097.1.17141 WP_002209097.1.17608 WP_002209097.1.17983 WP_002209097.1.18208 WP_002209097.1.18826 WP_002209097.1.19425 WP_002209097.1.19739 WP_002209097.1.19763 WP_002209097.1.2064 WP_002209097.1.21784 WP_002209097.1.21879 WP_002209097.1.21934 WP_002209097.1.22530 WP_002209097.1.22542 WP_002209097.1.22708 WP_002209097.1.23157 WP_002209097.1.23271 WP_002209097.1.23687 WP_002209097.1.23811 WP_002209097.1.24002 WP_002209097.1.25181 WP_002209097.1.25394 WP_002209097.1.26776 WP_002209097.1.26960 WP_002209097.1.27124 WP_002209097.1.27251 WP_002209097.1.2726 WP_002209097.1.28647 WP_002209097.1.28922 WP_002209097.1.29157 WP_002209097.1.29355 WP_002209097.1.2947 WP_002209097.1.29622 WP_002209097.1.2964 WP_002209097.1.29685 WP_002209097.1.29814 WP_002209097.1.3092 WP_002209097.1.30931 WP_002209097.1.311 WP_002209097.1.31336 WP_002209097.1.31496 WP_002209097.1.31739 WP_002209097.1.31805 WP_002209097.1.32343 WP_002209097.1.32388 WP_002209097.1.32446 WP_002209097.1.33661 WP_002209097.1.33937 WP_002209097.1.34031 WP_002209097.1.34138 WP_002209097.1.35389 WP_002209097.1.35538 WP_002209097.1.36088 WP_002209097.1.37174 WP_002209097.1.37494 WP_002209097.1.38147 WP_002209097.1.38235 WP_002209097.1.38743 WP_002209097.1.38824 WP_002209097.1.38993 WP_002209097.1.39066 WP_002209097.1.39346 WP_002209097.1.3976 WP_002209097.1.40071 WP_002209097.1.40134 WP_002209097.1.40534 WP_002209097.1.40853 WP_002209097.1.41196 WP_002209097.1.4210 WP_002209097.1.42490 WP_002209097.1.44408 WP_002209097.1.44598 WP_002209097.1.44603 WP_002209097.1.44832 WP_002209097.1.45198 WP_002209097.1.45214 WP_002209097.1.46262 WP_002209097.1.46545 WP_002209097.1.46731 WP_002209097.1.4678 WP_002209097.1.46891 WP_002209097.1.47387 WP_002209097.1.47440 WP_002209097.1.48166 WP_002209097.1.48722 WP_002209097.1.4889 WP_002209097.1.49906 WP_002209097.1.4997 WP_002209097.1.50010 WP_002209097.1.50093 WP_002209097.1.50106 WP_002209097.1.50984 WP_002209097.1.51284 WP_002209097.1.51588 WP_002209097.1.51772 WP_002209097.1.51934 WP_002209097.1.52158 WP_002209097.1.52247 WP_002209097.1.52734 WP_002209097.1.52969 WP_002209097.1.53848 WP_002209097.1.54568 WP_002209097.1.54951 WP_002209097.1.55695 WP_002209097.1.5592 WP_002209097.1.56031 WP_002209097.1.56912 WP_002209097.1.56953 WP_002209097.1.57585 WP_002209097.1.57657 WP_002209097.1.58794 WP_002209097.1.59431 WP_002209097.1.59635 WP_002209097.1.59687 WP_002209097.1.59789 WP_002209097.1.59885 WP_002209097.1.60437 WP_002209097.1.60707 WP_002209097.1.60896 WP_002209097.1.62232 WP_002209097.1.6270 WP_002209097.1.63387 WP_002209097.1.64474 WP_002209097.1.64780 WP_002209097.1.653 WP_002209097.1.65554 WP_002209097.1.6570 WP_002209097.1.65706 WP_002209097.1.65718 WP_002209097.1.6581 WP_002209097.1.66118 WP_002209097.1.67404 WP_002209097.1.67850 WP_002209097.1.68753 WP_002209097.1.68855 WP_002209097.1.69018 WP_002209097.1.69316 WP_002209097.1.69951 WP_002209097.1.70117 WP_002209097.1.70319 WP_002209097.1.70377 WP_002209097.1.70417 WP_002209097.1.70726 WP_002209097.1.7083 WP_002209097.1.7169 WP_002209097.1.71744 WP_002209097.1.72280 WP_002209097.1.72440 WP_002209097.1.72486 WP_002209097.1.7402 WP_002209097.1.74131 WP_002209097.1.74310 WP_002209097.1.74577 WP_002209097.1.74738 WP_002209097.1.75173 WP_002209097.1.7518 WP_002209097.1.75337 WP_002209097.1.75407 WP_002209097.1.75636 WP_002209097.1.75689 WP_002209097.1.75821 WP_002209097.1.76670 WP_002209097.1.77387 WP_002209097.1.77429 WP_002209097.1.77691 WP_002209097.1.78004 WP_002209097.1.7841 WP_002209097.1.79515 WP_002209097.1.79609 WP_002209097.1.8009 WP_002209097.1.8210 WP_002209097.1.82133 WP_002209097.1.82270 WP_002209097.1.82619 WP_002209097.1.8303 WP_002209097.1.83039 WP_002209097.1.83265 WP_002209097.1.84703 WP_002209097.1.85269 WP_002209097.1.85270 WP_002209097.1.8559 WP_002209097.1.85802 WP_002209097.1.86034 WP_002209097.1.86413 WP_002209097.1.87107 WP_002209097.1.8728 WP_002209097.1.87418 WP_002209097.1.8762 WP_002209097.1.87853 WP_002209097.1.87988 WP_002209097.1.88362 WP_002209097.1.88472 WP_002209097.1.89359 WP_002209097.1.8964 WP_002209097.1.90176 WP_002209097.1.9051 WP_002209097.1.90624 WP_002209097.1.91373 WP_002209097.1.92030 WP_002209097.1.92331 WP_002209097.1.92604 WP_002209097.1.927 WP_002209097.1.9311 WP_002209097.1.93623 WP_002209097.1.93928 WP_002209097.1.93933 WP_002209097.1.94052 WP_002209097.1.94201 WP_002209097.1.94545 WP_002209097.1.95746 WP_002209097.1.95981 WP_002209097.1.97245 WP_002209097.1.97448 WP_002209097.1.97864 WP_002209097.1.97872 WP_002209097.1.99109 WP_002209097.1.99383 WP_002209097.1.9941 WP_002209097.1.99416 WP_002209097.1.99788 WP_002209097.1.99990 YP_002345402.1.25044 gi|45440331|ref|NP_991870.1| gi|384137699|ref|YP_005520401.1| gi|145600897|ref|YP_001164973.1| gi|384120874|ref|YP_005503494.1| gi|162420983|ref|YP_001605329.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]