SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384121485|ref|YP_005504105.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384121485|ref|YP_005504105.1|
Domain Number 1 Region: 8-397
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.45e-108
Family Cystathionine synthase-like 0.0000000749
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384121485|ref|YP_005504105.1|
Sequence length 401
Comment hypothetical protein YPD4_0893 [Yersinia pestis D106004]
Sequence
MKVFNPMDFRREFPALSDKLTYLDSAATALKPRAMIDATQQFYQQDSATVHRSQHQSALS
LTVRFENTRQQVADFINSSTAENIIWTRGTTEAINLIAQSYARPRLQPEDEIIVSEAEHH
ANLIPWLMVAEQTGAKIVKLPLGLDHLPDLQQLPQLLNEKTRILALGQMSNVTGGSPDLA
QAIRLAHQYDCVVVVDGAQGIVHYPADVQALDIDFYAFSSHKLYGPTGIGVLYGKTELLE
EMPAWQGGGKMLTHASFGGFTPHEVPYRFEAGTPNIAGVIGLSAVLKWLEHIDLEEAEVY
SQGLATMAENKLAQLPGFHSYRCQQSSLLAFTFDGVHHSDLVALLAEQGIALRAGQHCAQ
PLMAALGVNGSLRASFAPYNTPQDVEMLCSALGKALELLRD
Download sequence
Identical sequences A0A0E1NQG9 A0A0M1V2I4 A0A208S7L9 A0A2A7VIL1 Q8CZY5
gi|162420213|ref|YP_001607575.1| gi|22127032|ref|NP_670455.1| WP_002212116.1.100083 WP_002212116.1.100246 WP_002212116.1.10066 WP_002212116.1.100921 WP_002212116.1.100931 WP_002212116.1.10105 WP_002212116.1.101305 WP_002212116.1.101382 WP_002212116.1.101928 WP_002212116.1.102012 WP_002212116.1.102067 WP_002212116.1.10736 WP_002212116.1.10935 WP_002212116.1.10955 WP_002212116.1.11693 WP_002212116.1.12463 WP_002212116.1.12736 WP_002212116.1.12857 WP_002212116.1.1388 WP_002212116.1.14063 WP_002212116.1.15321 WP_002212116.1.15555 WP_002212116.1.15605 WP_002212116.1.15689 WP_002212116.1.16243 WP_002212116.1.16333 WP_002212116.1.17135 WP_002212116.1.17141 WP_002212116.1.17608 WP_002212116.1.17873 WP_002212116.1.17983 WP_002212116.1.18208 WP_002212116.1.18640 WP_002212116.1.18826 WP_002212116.1.19329 WP_002212116.1.19425 WP_002212116.1.19739 WP_002212116.1.19763 WP_002212116.1.20035 WP_002212116.1.20547 WP_002212116.1.2064 WP_002212116.1.21486 WP_002212116.1.21784 WP_002212116.1.21879 WP_002212116.1.21934 WP_002212116.1.22530 WP_002212116.1.22542 WP_002212116.1.22708 WP_002212116.1.23157 WP_002212116.1.23271 WP_002212116.1.23687 WP_002212116.1.23811 WP_002212116.1.24002 WP_002212116.1.2451 WP_002212116.1.24517 WP_002212116.1.25181 WP_002212116.1.25394 WP_002212116.1.2640 WP_002212116.1.26776 WP_002212116.1.26960 WP_002212116.1.27124 WP_002212116.1.27251 WP_002212116.1.2726 WP_002212116.1.28922 WP_002212116.1.29157 WP_002212116.1.29355 WP_002212116.1.2947 WP_002212116.1.29622 WP_002212116.1.2964 WP_002212116.1.29685 WP_002212116.1.29814 WP_002212116.1.3092 WP_002212116.1.30931 WP_002212116.1.311 WP_002212116.1.31336 WP_002212116.1.31496 WP_002212116.1.31739 WP_002212116.1.31805 WP_002212116.1.32343 WP_002212116.1.32388 WP_002212116.1.32446 WP_002212116.1.33661 WP_002212116.1.33937 WP_002212116.1.34031 WP_002212116.1.34138 WP_002212116.1.35389 WP_002212116.1.35538 WP_002212116.1.36088 WP_002212116.1.37174 WP_002212116.1.37494 WP_002212116.1.37863 WP_002212116.1.38147 WP_002212116.1.38235 WP_002212116.1.38743 WP_002212116.1.38824 WP_002212116.1.38993 WP_002212116.1.39066 WP_002212116.1.39346 WP_002212116.1.3976 WP_002212116.1.40071 WP_002212116.1.40134 WP_002212116.1.40534 WP_002212116.1.40853 WP_002212116.1.41196 WP_002212116.1.4210 WP_002212116.1.42490 WP_002212116.1.42976 WP_002212116.1.44408 WP_002212116.1.44832 WP_002212116.1.45198 WP_002212116.1.45214 WP_002212116.1.46262 WP_002212116.1.46545 WP_002212116.1.46686 WP_002212116.1.4678 WP_002212116.1.46891 WP_002212116.1.47387 WP_002212116.1.47881 WP_002212116.1.48166 WP_002212116.1.48722 WP_002212116.1.4889 WP_002212116.1.49315 WP_002212116.1.49906 WP_002212116.1.4997 WP_002212116.1.50010 WP_002212116.1.50093 WP_002212116.1.50106 WP_002212116.1.50984 WP_002212116.1.51284 WP_002212116.1.51293 WP_002212116.1.51588 WP_002212116.1.51772 WP_002212116.1.51934 WP_002212116.1.52158 WP_002212116.1.52247 WP_002212116.1.52734 WP_002212116.1.52819 WP_002212116.1.52969 WP_002212116.1.53300 WP_002212116.1.53838 WP_002212116.1.53848 WP_002212116.1.53953 WP_002212116.1.54568 WP_002212116.1.54951 WP_002212116.1.55194 WP_002212116.1.55695 WP_002212116.1.5592 WP_002212116.1.56912 WP_002212116.1.56953 WP_002212116.1.57585 WP_002212116.1.57657 WP_002212116.1.58067 WP_002212116.1.58794 WP_002212116.1.59102 WP_002212116.1.59431 WP_002212116.1.5957 WP_002212116.1.59635 WP_002212116.1.59687 WP_002212116.1.59789 WP_002212116.1.59885 WP_002212116.1.60707 WP_002212116.1.60896 WP_002212116.1.61689 WP_002212116.1.62232 WP_002212116.1.62342 WP_002212116.1.6270 WP_002212116.1.63387 WP_002212116.1.64142 WP_002212116.1.64474 WP_002212116.1.64780 WP_002212116.1.64786 WP_002212116.1.64910 WP_002212116.1.653 WP_002212116.1.65400 WP_002212116.1.65554 WP_002212116.1.6570 WP_002212116.1.65706 WP_002212116.1.65718 WP_002212116.1.6581 WP_002212116.1.66118 WP_002212116.1.66546 WP_002212116.1.66616 WP_002212116.1.67404 WP_002212116.1.67850 WP_002212116.1.68361 WP_002212116.1.68753 WP_002212116.1.68855 WP_002212116.1.69018 WP_002212116.1.69316 WP_002212116.1.69951 WP_002212116.1.70117 WP_002212116.1.70171 WP_002212116.1.70319 WP_002212116.1.70377 WP_002212116.1.70417 WP_002212116.1.70726 WP_002212116.1.7083 WP_002212116.1.7169 WP_002212116.1.71744 WP_002212116.1.72280 WP_002212116.1.72440 WP_002212116.1.72486 WP_002212116.1.7402 WP_002212116.1.74131 WP_002212116.1.74310 WP_002212116.1.74577 WP_002212116.1.74738 WP_002212116.1.7518 WP_002212116.1.75337 WP_002212116.1.75407 WP_002212116.1.75636 WP_002212116.1.75689 WP_002212116.1.75821 WP_002212116.1.76670 WP_002212116.1.77387 WP_002212116.1.77429 WP_002212116.1.77691 WP_002212116.1.78004 WP_002212116.1.7841 WP_002212116.1.78556 WP_002212116.1.79515 WP_002212116.1.79550 WP_002212116.1.79609 WP_002212116.1.79981 WP_002212116.1.8009 WP_002212116.1.80331 WP_002212116.1.81848 WP_002212116.1.81877 WP_002212116.1.8210 WP_002212116.1.82133 WP_002212116.1.82151 WP_002212116.1.82270 WP_002212116.1.8303 WP_002212116.1.83039 WP_002212116.1.83265 WP_002212116.1.8420 WP_002212116.1.84703 WP_002212116.1.84720 WP_002212116.1.85269 WP_002212116.1.85270 WP_002212116.1.8559 WP_002212116.1.85802 WP_002212116.1.86034 WP_002212116.1.86059 WP_002212116.1.86413 WP_002212116.1.87107 WP_002212116.1.8728 WP_002212116.1.87418 WP_002212116.1.8762 WP_002212116.1.87853 WP_002212116.1.87988 WP_002212116.1.88362 WP_002212116.1.88472 WP_002212116.1.89359 WP_002212116.1.8964 WP_002212116.1.90176 WP_002212116.1.9051 WP_002212116.1.90624 WP_002212116.1.91373 WP_002212116.1.91844 WP_002212116.1.92030 WP_002212116.1.92331 WP_002212116.1.92604 WP_002212116.1.927 WP_002212116.1.9311 WP_002212116.1.9320 WP_002212116.1.93623 WP_002212116.1.93928 WP_002212116.1.93933 WP_002212116.1.94052 WP_002212116.1.94201 WP_002212116.1.94545 WP_002212116.1.94683 WP_002212116.1.95746 WP_002212116.1.95981 WP_002212116.1.97245 WP_002212116.1.97375 WP_002212116.1.97448 WP_002212116.1.97791 WP_002212116.1.97864 WP_002212116.1.97872 WP_002212116.1.97894 WP_002212116.1.99109 WP_002212116.1.99383 WP_002212116.1.9941 WP_002212116.1.99416 WP_002212116.1.99788 WP_002212116.1.99990 gi|384413655|ref|YP_005623017.1| 187410.y3156 349746.YpAngola_A3222 gi|384141106|ref|YP_005523808.1| gi|294503045|ref|YP_003567107.1| gi|384121485|ref|YP_005504105.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]