SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384121843|ref|YP_005504463.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384121843|ref|YP_005504463.1|
Domain Number 1 Region: 1-396
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.97e-116
Family AAT-like 0.00000000000584
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384121843|ref|YP_005504463.1|
Sequence length 396
Comment aspartate aminotransferase [Yersinia pestis D106004]
Sequence
MFEKITAAPADPILGLTDIFRADDRAHKINLGIGVYKDETGKTPVLTSVKKAEQYLLENE
ATKNYLGIDGLPVFASCTQELLFGANSAIIADKRARTAQTPGGTGGLRIAADFIAHQTSA
KRVWVSNPSWPNHKNVFEAAGLEVVEYAYYDAANHALDFDGLLNSLSEAQAGDVVLFHGC
CHNPTGIDPTETQWSQLAELSVAKGWLPLFDFAYQGFANGLEEDAQGLRIFAATHQELIV
CSSYSKNFGLYNERVGACTLVAADSNVADTAFSQVKAVIRANYSNPPAHGASVVATILSN
AALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGAQQDFSFIINQNGMFSFSGLTKEQVLR
LRDEFAVYAVNSGRVNVAGMTPDNMAPLCEAIVAVL
Download sequence
Identical sequences A0A0E1NQX6 A0A0M1V4Y4 A0A0U1EQ24 A0A0U1QZT5 A0A208RUJ6 Q0WH05 Q66CG9
gi|51595774|ref|YP_069965.1| gi|153949374|ref|YP_001401525.1| gi|384415223|ref|YP_005624585.1| gi|218928558|ref|YP_002346433.1| gi|294503397|ref|YP_003567459.1| WP_002211303.1.100083 WP_002211303.1.100246 WP_002211303.1.100593 WP_002211303.1.100921 WP_002211303.1.100931 WP_002211303.1.10105 WP_002211303.1.101305 WP_002211303.1.101382 WP_002211303.1.101928 WP_002211303.1.102012 WP_002211303.1.102067 WP_002211303.1.10736 WP_002211303.1.10935 WP_002211303.1.10955 WP_002211303.1.11693 WP_002211303.1.12167 WP_002211303.1.12463 WP_002211303.1.12736 WP_002211303.1.12857 WP_002211303.1.1388 WP_002211303.1.14063 WP_002211303.1.14169 WP_002211303.1.14804 WP_002211303.1.15321 WP_002211303.1.15555 WP_002211303.1.15605 WP_002211303.1.15689 WP_002211303.1.16243 WP_002211303.1.16333 WP_002211303.1.17135 WP_002211303.1.17141 WP_002211303.1.17608 WP_002211303.1.17873 WP_002211303.1.17983 WP_002211303.1.18208 WP_002211303.1.18640 WP_002211303.1.18826 WP_002211303.1.19329 WP_002211303.1.19425 WP_002211303.1.19763 WP_002211303.1.20035 WP_002211303.1.20380 WP_002211303.1.2064 WP_002211303.1.20932 WP_002211303.1.21486 WP_002211303.1.21784 WP_002211303.1.21879 WP_002211303.1.21934 WP_002211303.1.22530 WP_002211303.1.22542 WP_002211303.1.22708 WP_002211303.1.23157 WP_002211303.1.23271 WP_002211303.1.23687 WP_002211303.1.23811 WP_002211303.1.24002 WP_002211303.1.2451 WP_002211303.1.25181 WP_002211303.1.25394 WP_002211303.1.26383 WP_002211303.1.2640 WP_002211303.1.26776 WP_002211303.1.26960 WP_002211303.1.27124 WP_002211303.1.27251 WP_002211303.1.2726 WP_002211303.1.28647 WP_002211303.1.28922 WP_002211303.1.29157 WP_002211303.1.29186 WP_002211303.1.29355 WP_002211303.1.2947 WP_002211303.1.29622 WP_002211303.1.2964 WP_002211303.1.29685 WP_002211303.1.29814 WP_002211303.1.3092 WP_002211303.1.30931 WP_002211303.1.311 WP_002211303.1.31336 WP_002211303.1.31496 WP_002211303.1.31721 WP_002211303.1.31739 WP_002211303.1.31805 WP_002211303.1.32343 WP_002211303.1.32388 WP_002211303.1.32446 WP_002211303.1.32736 WP_002211303.1.33324 WP_002211303.1.33661 WP_002211303.1.33775 WP_002211303.1.33937 WP_002211303.1.34031 WP_002211303.1.34138 WP_002211303.1.35389 WP_002211303.1.35538 WP_002211303.1.37174 WP_002211303.1.37494 WP_002211303.1.37863 WP_002211303.1.38147 WP_002211303.1.38235 WP_002211303.1.38743 WP_002211303.1.38824 WP_002211303.1.38993 WP_002211303.1.39066 WP_002211303.1.39346 WP_002211303.1.3976 WP_002211303.1.39858 WP_002211303.1.40071 WP_002211303.1.40134 WP_002211303.1.40534 WP_002211303.1.40853 WP_002211303.1.41196 WP_002211303.1.4210 WP_002211303.1.42361 WP_002211303.1.42490 WP_002211303.1.44408 WP_002211303.1.44598 WP_002211303.1.44603 WP_002211303.1.44832 WP_002211303.1.45198 WP_002211303.1.45214 WP_002211303.1.46262 WP_002211303.1.46545 WP_002211303.1.46686 WP_002211303.1.46697 WP_002211303.1.46731 WP_002211303.1.4678 WP_002211303.1.46891 WP_002211303.1.47387 WP_002211303.1.47440 WP_002211303.1.47769 WP_002211303.1.48166 WP_002211303.1.48722 WP_002211303.1.4889 WP_002211303.1.49906 WP_002211303.1.4997 WP_002211303.1.50010 WP_002211303.1.50093 WP_002211303.1.50106 WP_002211303.1.50185 WP_002211303.1.50984 WP_002211303.1.51284 WP_002211303.1.51293 WP_002211303.1.51588 WP_002211303.1.51772 WP_002211303.1.51934 WP_002211303.1.52158 WP_002211303.1.52734 WP_002211303.1.52819 WP_002211303.1.52969 WP_002211303.1.53300 WP_002211303.1.53838 WP_002211303.1.53883 WP_002211303.1.53953 WP_002211303.1.54568 WP_002211303.1.54951 WP_002211303.1.55194 WP_002211303.1.55695 WP_002211303.1.5592 WP_002211303.1.56031 WP_002211303.1.56912 WP_002211303.1.56953 WP_002211303.1.57585 WP_002211303.1.57657 WP_002211303.1.58067 WP_002211303.1.58543 WP_002211303.1.58794 WP_002211303.1.59102 WP_002211303.1.59431 WP_002211303.1.5957 WP_002211303.1.59635 WP_002211303.1.5968 WP_002211303.1.59687 WP_002211303.1.59789 WP_002211303.1.59885 WP_002211303.1.60437 WP_002211303.1.60707 WP_002211303.1.60896 WP_002211303.1.61689 WP_002211303.1.62232 WP_002211303.1.62342 WP_002211303.1.6270 WP_002211303.1.63387 WP_002211303.1.63641 WP_002211303.1.64142 WP_002211303.1.64474 WP_002211303.1.64780 WP_002211303.1.64786 WP_002211303.1.64910 WP_002211303.1.65554 WP_002211303.1.6570 WP_002211303.1.65706 WP_002211303.1.65718 WP_002211303.1.6581 WP_002211303.1.66118 WP_002211303.1.66616 WP_002211303.1.67404 WP_002211303.1.67850 WP_002211303.1.6791 WP_002211303.1.68361 WP_002211303.1.68753 WP_002211303.1.68855 WP_002211303.1.69018 WP_002211303.1.69316 WP_002211303.1.69951 WP_002211303.1.70117 WP_002211303.1.70171 WP_002211303.1.70319 WP_002211303.1.70377 WP_002211303.1.70417 WP_002211303.1.70726 WP_002211303.1.7083 WP_002211303.1.7169 WP_002211303.1.71744 WP_002211303.1.72280 WP_002211303.1.72486 WP_002211303.1.7402 WP_002211303.1.74131 WP_002211303.1.74310 WP_002211303.1.74738 WP_002211303.1.75169 WP_002211303.1.75173 WP_002211303.1.7518 WP_002211303.1.75208 WP_002211303.1.75337 WP_002211303.1.75407 WP_002211303.1.75636 WP_002211303.1.75689 WP_002211303.1.75821 WP_002211303.1.76670 WP_002211303.1.77295 WP_002211303.1.77387 WP_002211303.1.77429 WP_002211303.1.77569 WP_002211303.1.77691 WP_002211303.1.78004 WP_002211303.1.7841 WP_002211303.1.78556 WP_002211303.1.79515 WP_002211303.1.79550 WP_002211303.1.79609 WP_002211303.1.79825 WP_002211303.1.79981 WP_002211303.1.8009 WP_002211303.1.80331 WP_002211303.1.81848 WP_002211303.1.81877 WP_002211303.1.8210 WP_002211303.1.82133 WP_002211303.1.82151 WP_002211303.1.82270 WP_002211303.1.82619 WP_002211303.1.8303 WP_002211303.1.83039 WP_002211303.1.83265 WP_002211303.1.83630 WP_002211303.1.8420 WP_002211303.1.84703 WP_002211303.1.84720 WP_002211303.1.85269 WP_002211303.1.85270 WP_002211303.1.8559 WP_002211303.1.85802 WP_002211303.1.86034 WP_002211303.1.86413 WP_002211303.1.8728 WP_002211303.1.87418 WP_002211303.1.8762 WP_002211303.1.87853 WP_002211303.1.87988 WP_002211303.1.88362 WP_002211303.1.88472 WP_002211303.1.89359 WP_002211303.1.8964 WP_002211303.1.90176 WP_002211303.1.9051 WP_002211303.1.90624 WP_002211303.1.91263 WP_002211303.1.91373 WP_002211303.1.91844 WP_002211303.1.92030 WP_002211303.1.92331 WP_002211303.1.92604 WP_002211303.1.927 WP_002211303.1.9311 WP_002211303.1.9320 WP_002211303.1.93623 WP_002211303.1.93928 WP_002211303.1.93933 WP_002211303.1.94052 WP_002211303.1.94201 WP_002211303.1.94545 WP_002211303.1.94683 WP_002211303.1.95746 WP_002211303.1.95981 WP_002211303.1.97245 WP_002211303.1.97448 WP_002211303.1.97791 WP_002211303.1.97864 WP_002211303.1.97872 WP_002211303.1.97894 WP_002211303.1.99109 WP_002211303.1.99383 WP_002211303.1.9941 WP_002211303.1.99416 WP_002211303.1.99788 WP_002211303.1.99972 WP_002211303.1.99990 YP_002346433.1.25044 187410.y2760 214092.YPO1410 229193.YP_1183 273123.YPTB1434 349746.YpAngola_A1976 349747.YpsIP31758_2560 502801.YPTS_1536 gi|162421411|ref|YP_001606450.1| gi|186894853|ref|YP_001871965.1| gi|161511415|ref|NP_992549.2| gi|161484776|ref|NP_670061.2| gi|384140772|ref|YP_005523474.1| gi|384125362|ref|YP_005507976.1| gi|384121843|ref|YP_005504463.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]