SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384121949|ref|YP_005504569.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384121949|ref|YP_005504569.1|
Domain Number 1 Region: 292-426
Classification Level Classification E-value
Superfamily CBS-domain pair 5.68e-25
Family CBS-domain pair 0.0039
Further Details:      
 
Domain Number 2 Region: 439-530
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.53e-18
Family CorC/HlyC domain-like 0.0013
Further Details:      
 
Weak hits

Sequence:  gi|384121949|ref|YP_005504569.1|
Domain Number - Region: 16-193
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0405
Family Calcium ATPase, transmembrane domain M 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384121949|ref|YP_005504569.1|
Sequence length 537
Comment hypothetical protein YPD4_1358 [Yersinia pestis D106004]
Sequence
MEWIADPTIWAGLATLVVLEIVLGIDNLIFIAILAEKLPRHQRDKARVTGLLCALLMRLA
LLACISWLATLTTPIVTLSEHSFSARDLIMLVGGIFLLFKATMELNERLEGKDHQQNQQR
KAARFWPVVAQIVVLDAIFSLDSVITAVGMVDHLAVMMVAVCIAIGLMLLASKPLTRFVN
AHPTIVILCLSFLLMIGFSLVAEGFGYHIPKGYLYAAIGFSVIIESLNQFAQFNRRRFLS
TVRPLRERTAEAVLRMLSGKHEEAELDNHTANLIADNTSEGQEVFNAQERRMIERVLGLA
QRTVSSIMTSRHDVEYLDLNDPPEKLTQLLAKNLHTRIVVTEDSSTDEPLGVIHVIDLLK
QQLANEKLDLRSLIRQPLIFPEQVSLLMALEQFRQAQTHFAFVVDEFGSIEGVVTLTDVM
ETIAGNLPVAGEELDARHDIQQTEDGCWIANGYMPLEDLVLYLPLEDLVLYLPLPIDEKR
EYHTLAGLLMEHTQRIPKVGEQLTIGDYLFEPLVVNSHRILKVKITPLKIPEPDYEV
Download sequence
Identical sequences A0A0E1NUU9 A0A0H2YIQ5 A0A208S369 Q8D075
187410.y2643 360102.YPA_0821 377628.YPN_2453 gi|384415098|ref|YP_005624460.1| gi|108806818|ref|YP_650734.1| gi|22126522|ref|NP_669945.1| WP_002223436.1.102012 WP_002223436.1.12857 WP_002223436.1.16333 WP_002223436.1.18826 WP_002223436.1.19329 WP_002223436.1.2064 WP_002223436.1.21879 WP_002223436.1.23157 WP_002223436.1.24002 WP_002223436.1.29355 WP_002223436.1.311 WP_002223436.1.31739 WP_002223436.1.36088 WP_002223436.1.40853 WP_002223436.1.46262 WP_002223436.1.4678 WP_002223436.1.56031 WP_002223436.1.56912 WP_002223436.1.57585 WP_002223436.1.57657 WP_002223436.1.59789 WP_002223436.1.60437 WP_002223436.1.65554 WP_002223436.1.69316 WP_002223436.1.72280 WP_002223436.1.7518 WP_002223436.1.8210 WP_002223436.1.84703 WP_002223436.1.85802 WP_002223436.1.88472 WP_002223436.1.92331 WP_002223436.1.92604 WP_002223436.1.94052 gi|384126052|ref|YP_005508666.1| gi|384121949|ref|YP_005504569.1| gi|294503502|ref|YP_003567564.1| gi|108812614|ref|YP_648381.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]