SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384121969|ref|YP_005504589.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384121969|ref|YP_005504589.1|
Domain Number 1 Region: 5-353
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.81e-81
Family AAT-like 0.000000000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384121969|ref|YP_005504589.1|
Sequence length 382
Comment histidinol-phosphate aminotransferase [Yersinia pestis D106004]
Sequence
MSQSNNVTDLARANIRALTPYMSARRLGGNGDVWLNANEYPLGTEYQLTTQTFNRYPECQ
PKHVIERYAAYAGLPPEQVLVSRGADEGIELLIRAFCEPGQDAILFCPPTYGMYAVSAET
FGVERRTVPAQADWQLDLPAIANNLEQVKVIYVCSPNNPTGNLINPADLQAVLALAQGRA
IVAIDEAYIEFCPQASVSNWLKDYPNLVILRTLSKAFALAGLRCGFTLANSDIIQLLLKV
IAPYPLSTPVADIAAQALSPKGIEQMRQRVSEVRANRAWLQSALQDCACVEQVFTSESNY
LLARFTASSSVFNALWDQGIILRDQNKQPGLANCLRITIGTRQECERVIAALAPLPGIDN
SNNIDNQNKTYSQTSSIRKGTI
Download sequence
Identical sequences A0A0E1NRA2 A0A0M1V3N6 A0A208S345 A4TKK4 A9R2K5 Q1C9R1 Q1CGX0 Q8ZFX6
187410.y2622 214092.YPO1547 229193.YP_1436 349746.YpAngola_A3171 360102.YPA_0843 377628.YPN_2432 386656.YPDSF_1429 gi|294503522|ref|YP_003567584.1| gi|162420699|ref|YP_001607531.1| WP_002211894.1.100083 WP_002211894.1.100246 WP_002211894.1.100921 WP_002211894.1.100931 WP_002211894.1.10105 WP_002211894.1.101305 WP_002211894.1.101382 WP_002211894.1.101928 WP_002211894.1.102012 WP_002211894.1.102067 WP_002211894.1.10736 WP_002211894.1.10935 WP_002211894.1.10955 WP_002211894.1.11693 WP_002211894.1.12463 WP_002211894.1.12736 WP_002211894.1.12857 WP_002211894.1.1388 WP_002211894.1.14063 WP_002211894.1.14804 WP_002211894.1.15321 WP_002211894.1.15555 WP_002211894.1.15605 WP_002211894.1.15689 WP_002211894.1.16243 WP_002211894.1.16333 WP_002211894.1.17135 WP_002211894.1.17141 WP_002211894.1.17608 WP_002211894.1.17873 WP_002211894.1.17983 WP_002211894.1.18208 WP_002211894.1.18640 WP_002211894.1.18826 WP_002211894.1.19329 WP_002211894.1.19425 WP_002211894.1.19739 WP_002211894.1.20035 WP_002211894.1.2064 WP_002211894.1.21486 WP_002211894.1.21784 WP_002211894.1.21879 WP_002211894.1.21934 WP_002211894.1.22530 WP_002211894.1.22542 WP_002211894.1.22708 WP_002211894.1.23157 WP_002211894.1.23271 WP_002211894.1.23687 WP_002211894.1.23811 WP_002211894.1.24002 WP_002211894.1.2451 WP_002211894.1.25181 WP_002211894.1.25394 WP_002211894.1.2640 WP_002211894.1.26776 WP_002211894.1.26960 WP_002211894.1.27124 WP_002211894.1.27251 WP_002211894.1.2726 WP_002211894.1.28647 WP_002211894.1.28922 WP_002211894.1.29157 WP_002211894.1.29355 WP_002211894.1.2947 WP_002211894.1.29622 WP_002211894.1.2964 WP_002211894.1.29685 WP_002211894.1.29814 WP_002211894.1.3092 WP_002211894.1.30931 WP_002211894.1.311 WP_002211894.1.31336 WP_002211894.1.31496 WP_002211894.1.31739 WP_002211894.1.31805 WP_002211894.1.32343 WP_002211894.1.32388 WP_002211894.1.32446 WP_002211894.1.33203 WP_002211894.1.33661 WP_002211894.1.33937 WP_002211894.1.34031 WP_002211894.1.34138 WP_002211894.1.35389 WP_002211894.1.35538 WP_002211894.1.36088 WP_002211894.1.37174 WP_002211894.1.37494 WP_002211894.1.37863 WP_002211894.1.38147 WP_002211894.1.38235 WP_002211894.1.38743 WP_002211894.1.38824 WP_002211894.1.38993 WP_002211894.1.39066 WP_002211894.1.39346 WP_002211894.1.3976 WP_002211894.1.40071 WP_002211894.1.40134 WP_002211894.1.40534 WP_002211894.1.40853 WP_002211894.1.41196 WP_002211894.1.4210 WP_002211894.1.44408 WP_002211894.1.44598 WP_002211894.1.44832 WP_002211894.1.45198 WP_002211894.1.45214 WP_002211894.1.46262 WP_002211894.1.46545 WP_002211894.1.46686 WP_002211894.1.46731 WP_002211894.1.4678 WP_002211894.1.46891 WP_002211894.1.47387 WP_002211894.1.47440 WP_002211894.1.48166 WP_002211894.1.48722 WP_002211894.1.4889 WP_002211894.1.49906 WP_002211894.1.4997 WP_002211894.1.50010 WP_002211894.1.50093 WP_002211894.1.50106 WP_002211894.1.50984 WP_002211894.1.51284 WP_002211894.1.51293 WP_002211894.1.51588 WP_002211894.1.51772 WP_002211894.1.51934 WP_002211894.1.52158 WP_002211894.1.52247 WP_002211894.1.52734 WP_002211894.1.52819 WP_002211894.1.52969 WP_002211894.1.53300 WP_002211894.1.53838 WP_002211894.1.53848 WP_002211894.1.53953 WP_002211894.1.54568 WP_002211894.1.54951 WP_002211894.1.55194 WP_002211894.1.55695 WP_002211894.1.5592 WP_002211894.1.56031 WP_002211894.1.56912 WP_002211894.1.56953 WP_002211894.1.57585 WP_002211894.1.57657 WP_002211894.1.58067 WP_002211894.1.59102 WP_002211894.1.59431 WP_002211894.1.5957 WP_002211894.1.59635 WP_002211894.1.59687 WP_002211894.1.59789 WP_002211894.1.59885 WP_002211894.1.60437 WP_002211894.1.60707 WP_002211894.1.60896 WP_002211894.1.61689 WP_002211894.1.62232 WP_002211894.1.62342 WP_002211894.1.6270 WP_002211894.1.63387 WP_002211894.1.64142 WP_002211894.1.64474 WP_002211894.1.64780 WP_002211894.1.64786 WP_002211894.1.64910 WP_002211894.1.653 WP_002211894.1.65400 WP_002211894.1.65554 WP_002211894.1.6570 WP_002211894.1.65706 WP_002211894.1.65718 WP_002211894.1.6581 WP_002211894.1.66546 WP_002211894.1.66616 WP_002211894.1.67404 WP_002211894.1.67850 WP_002211894.1.68361 WP_002211894.1.68753 WP_002211894.1.68855 WP_002211894.1.69018 WP_002211894.1.69316 WP_002211894.1.69951 WP_002211894.1.70117 WP_002211894.1.70171 WP_002211894.1.70319 WP_002211894.1.70377 WP_002211894.1.70417 WP_002211894.1.70726 WP_002211894.1.7083 WP_002211894.1.7169 WP_002211894.1.71744 WP_002211894.1.72280 WP_002211894.1.72440 WP_002211894.1.72486 WP_002211894.1.7402 WP_002211894.1.74131 WP_002211894.1.74310 WP_002211894.1.74577 WP_002211894.1.74738 WP_002211894.1.75173 WP_002211894.1.7518 WP_002211894.1.75337 WP_002211894.1.75407 WP_002211894.1.75636 WP_002211894.1.75689 WP_002211894.1.75821 WP_002211894.1.76670 WP_002211894.1.77387 WP_002211894.1.77429 WP_002211894.1.78004 WP_002211894.1.7841 WP_002211894.1.78556 WP_002211894.1.79515 WP_002211894.1.79550 WP_002211894.1.79609 WP_002211894.1.79981 WP_002211894.1.8009 WP_002211894.1.80331 WP_002211894.1.81848 WP_002211894.1.81877 WP_002211894.1.8210 WP_002211894.1.82133 WP_002211894.1.82151 WP_002211894.1.82270 WP_002211894.1.82619 WP_002211894.1.8303 WP_002211894.1.83039 WP_002211894.1.83265 WP_002211894.1.8420 WP_002211894.1.84703 WP_002211894.1.84720 WP_002211894.1.85269 WP_002211894.1.85270 WP_002211894.1.8559 WP_002211894.1.85802 WP_002211894.1.86034 WP_002211894.1.87107 WP_002211894.1.8728 WP_002211894.1.87418 WP_002211894.1.8762 WP_002211894.1.87853 WP_002211894.1.87988 WP_002211894.1.88362 WP_002211894.1.88472 WP_002211894.1.89359 WP_002211894.1.8964 WP_002211894.1.90176 WP_002211894.1.90624 WP_002211894.1.91373 WP_002211894.1.91844 WP_002211894.1.92030 WP_002211894.1.92331 WP_002211894.1.92604 WP_002211894.1.927 WP_002211894.1.9311 WP_002211894.1.9320 WP_002211894.1.93623 WP_002211894.1.93928 WP_002211894.1.93933 WP_002211894.1.94052 WP_002211894.1.94201 WP_002211894.1.94545 WP_002211894.1.94683 WP_002211894.1.95746 WP_002211894.1.95981 WP_002211894.1.97375 WP_002211894.1.97448 WP_002211894.1.97791 WP_002211894.1.97864 WP_002211894.1.97872 WP_002211894.1.97894 WP_002211894.1.99109 WP_002211894.1.99383 WP_002211894.1.9941 WP_002211894.1.99416 WP_002211894.1.99788 WP_002211894.1.99990 YP_002346563.1.25044 gi|22126502|ref|NP_669925.1| gi|218928688|ref|YP_002346563.1| gi|384415081|ref|YP_005624443.1| gi|384121969|ref|YP_005504589.1| gi|108812593|ref|YP_648360.1| gi|384126031|ref|YP_005508645.1| gi|108806840|ref|YP_650756.1| gi|45441261|ref|NP_992800.1| gi|145598713|ref|YP_001162789.1| gi|384140568|ref|YP_005523270.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]