SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384122042|ref|YP_005504662.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384122042|ref|YP_005504662.1|
Domain Number 1 Region: 4-401
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.93e-126
Family Cystathionine synthase-like 0.000000000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384122042|ref|YP_005504662.1|
Sequence length 406
Comment selenocysteine lyase [Yersinia pestis D106004]
Sequence
MNFPIERVRADFPLLSRQVNGQPLVYLDSAASAQKPQAVIDKELHFYRDGYAAVHRGIHS
LSAEATQQMEAVRTQVADFIHAASAEEIIFVRGTTEAINLVANSYGRHFLAAGDSIIITE
MEHHANIVPWQMLAQDLGVEIRVWPLTATGELEITALAALIDDTTRLLAVTQVSNVLGTV
NPIKDIVAQAKAAGLVVLVDGAQAVMHQPVDVQALGCDFYVFSGHKLYGPSGIGILYGKS
ALLQQMPPWEGGGAMIKTVSLTQGTTFADAPWRFEAGSPNTAGIMGLGAAIDYVTELGLL
PIQQYEQSLMHYALAQLSQIKSLTLYGPTERAGVIAFNLGQHHAYDVGSFLDQYGIAIRT
GHHCAMPLMAFYQVPSMCRASLALYNTREDVDRLVAGLQRIEKLLG
Download sequence
Identical sequences A0A0E1NMQ3 A0A0M1V3E5 A0A154RTV5 A0A208S483 A4TIP2 B1JJ48 Q1C761 Q1CIJ6 Q8D0M6
WP_002211805.1.100083 WP_002211805.1.100246 WP_002211805.1.100921 WP_002211805.1.100931 WP_002211805.1.10105 WP_002211805.1.101305 WP_002211805.1.101382 WP_002211805.1.101928 WP_002211805.1.102012 WP_002211805.1.102067 WP_002211805.1.10736 WP_002211805.1.10935 WP_002211805.1.10955 WP_002211805.1.11693 WP_002211805.1.12463 WP_002211805.1.12736 WP_002211805.1.12857 WP_002211805.1.1388 WP_002211805.1.14063 WP_002211805.1.14804 WP_002211805.1.15321 WP_002211805.1.15555 WP_002211805.1.15605 WP_002211805.1.15689 WP_002211805.1.16243 WP_002211805.1.16333 WP_002211805.1.17135 WP_002211805.1.17141 WP_002211805.1.17608 WP_002211805.1.17873 WP_002211805.1.17983 WP_002211805.1.18208 WP_002211805.1.18640 WP_002211805.1.18826 WP_002211805.1.19329 WP_002211805.1.19425 WP_002211805.1.19739 WP_002211805.1.19763 WP_002211805.1.20035 WP_002211805.1.2064 WP_002211805.1.21486 WP_002211805.1.21784 WP_002211805.1.21879 WP_002211805.1.21934 WP_002211805.1.22530 WP_002211805.1.22542 WP_002211805.1.22708 WP_002211805.1.23157 WP_002211805.1.23271 WP_002211805.1.23687 WP_002211805.1.23811 WP_002211805.1.24002 WP_002211805.1.2451 WP_002211805.1.25181 WP_002211805.1.25394 WP_002211805.1.2640 WP_002211805.1.26776 WP_002211805.1.26960 WP_002211805.1.27124 WP_002211805.1.27251 WP_002211805.1.2726 WP_002211805.1.28647 WP_002211805.1.28922 WP_002211805.1.29157 WP_002211805.1.29355 WP_002211805.1.2947 WP_002211805.1.29622 WP_002211805.1.2964 WP_002211805.1.29685 WP_002211805.1.29814 WP_002211805.1.3092 WP_002211805.1.30931 WP_002211805.1.311 WP_002211805.1.31336 WP_002211805.1.31496 WP_002211805.1.31739 WP_002211805.1.31805 WP_002211805.1.32343 WP_002211805.1.32388 WP_002211805.1.32446 WP_002211805.1.33203 WP_002211805.1.33661 WP_002211805.1.33937 WP_002211805.1.34031 WP_002211805.1.34138 WP_002211805.1.35389 WP_002211805.1.35538 WP_002211805.1.36088 WP_002211805.1.37174 WP_002211805.1.37494 WP_002211805.1.37863 WP_002211805.1.38147 WP_002211805.1.38235 WP_002211805.1.38532 WP_002211805.1.38743 WP_002211805.1.38824 WP_002211805.1.38993 WP_002211805.1.39066 WP_002211805.1.39346 WP_002211805.1.3976 WP_002211805.1.40071 WP_002211805.1.40134 WP_002211805.1.40534 WP_002211805.1.40853 WP_002211805.1.41196 WP_002211805.1.42490 WP_002211805.1.44408 WP_002211805.1.44598 WP_002211805.1.44603 WP_002211805.1.44832 WP_002211805.1.45198 WP_002211805.1.45214 WP_002211805.1.46262 WP_002211805.1.46545 WP_002211805.1.46686 WP_002211805.1.46731 WP_002211805.1.4678 WP_002211805.1.46891 WP_002211805.1.47387 WP_002211805.1.47440 WP_002211805.1.47769 WP_002211805.1.48166 WP_002211805.1.48722 WP_002211805.1.4889 WP_002211805.1.49906 WP_002211805.1.4997 WP_002211805.1.50010 WP_002211805.1.50093 WP_002211805.1.50106 WP_002211805.1.50984 WP_002211805.1.51284 WP_002211805.1.51293 WP_002211805.1.51588 WP_002211805.1.51772 WP_002211805.1.51934 WP_002211805.1.52158 WP_002211805.1.52247 WP_002211805.1.52473 WP_002211805.1.52734 WP_002211805.1.52792 WP_002211805.1.52819 WP_002211805.1.52969 WP_002211805.1.53300 WP_002211805.1.53838 WP_002211805.1.53848 WP_002211805.1.53953 WP_002211805.1.54568 WP_002211805.1.54951 WP_002211805.1.55194 WP_002211805.1.55695 WP_002211805.1.5592 WP_002211805.1.56031 WP_002211805.1.56912 WP_002211805.1.56953 WP_002211805.1.57585 WP_002211805.1.57657 WP_002211805.1.58067 WP_002211805.1.58794 WP_002211805.1.59102 WP_002211805.1.59431 WP_002211805.1.5957 WP_002211805.1.59635 WP_002211805.1.59789 WP_002211805.1.59885 WP_002211805.1.60437 WP_002211805.1.60707 WP_002211805.1.60896 WP_002211805.1.61689 WP_002211805.1.62232 WP_002211805.1.62342 WP_002211805.1.6270 WP_002211805.1.63387 WP_002211805.1.64142 WP_002211805.1.64474 WP_002211805.1.64780 WP_002211805.1.64786 WP_002211805.1.64910 WP_002211805.1.653 WP_002211805.1.65400 WP_002211805.1.65554 WP_002211805.1.6570 WP_002211805.1.65706 WP_002211805.1.65718 WP_002211805.1.6581 WP_002211805.1.66118 WP_002211805.1.66546 WP_002211805.1.66616 WP_002211805.1.67404 WP_002211805.1.67850 WP_002211805.1.68361 WP_002211805.1.68371 WP_002211805.1.68855 WP_002211805.1.69018 WP_002211805.1.69316 WP_002211805.1.69951 WP_002211805.1.70117 WP_002211805.1.70171 WP_002211805.1.70319 WP_002211805.1.70377 WP_002211805.1.70726 WP_002211805.1.7083 WP_002211805.1.7169 WP_002211805.1.71744 WP_002211805.1.72280 WP_002211805.1.72440 WP_002211805.1.72486 WP_002211805.1.7402 WP_002211805.1.74310 WP_002211805.1.74577 WP_002211805.1.74738 WP_002211805.1.75173 WP_002211805.1.7518 WP_002211805.1.75337 WP_002211805.1.75636 WP_002211805.1.75689 WP_002211805.1.75821 WP_002211805.1.76555 WP_002211805.1.76670 WP_002211805.1.77387 WP_002211805.1.77429 WP_002211805.1.78004 WP_002211805.1.7841 WP_002211805.1.78556 WP_002211805.1.79515 WP_002211805.1.79550 WP_002211805.1.79609 WP_002211805.1.79981 WP_002211805.1.8009 WP_002211805.1.80331 WP_002211805.1.81848 WP_002211805.1.81877 WP_002211805.1.8210 WP_002211805.1.82133 WP_002211805.1.82151 WP_002211805.1.82270 WP_002211805.1.82436 WP_002211805.1.82619 WP_002211805.1.8303 WP_002211805.1.83039 WP_002211805.1.83265 WP_002211805.1.83630 WP_002211805.1.8420 WP_002211805.1.84703 WP_002211805.1.84720 WP_002211805.1.85269 WP_002211805.1.85270 WP_002211805.1.8559 WP_002211805.1.85802 WP_002211805.1.86034 WP_002211805.1.87107 WP_002211805.1.8728 WP_002211805.1.87418 WP_002211805.1.8762 WP_002211805.1.87853 WP_002211805.1.87988 WP_002211805.1.88362 WP_002211805.1.88472 WP_002211805.1.89359 WP_002211805.1.89542 WP_002211805.1.8964 WP_002211805.1.90176 WP_002211805.1.9051 WP_002211805.1.90624 WP_002211805.1.91373 WP_002211805.1.91844 WP_002211805.1.92030 WP_002211805.1.92331 WP_002211805.1.92604 WP_002211805.1.927 WP_002211805.1.9311 WP_002211805.1.9320 WP_002211805.1.93623 WP_002211805.1.93928 WP_002211805.1.93933 WP_002211805.1.94052 WP_002211805.1.94201 WP_002211805.1.94545 WP_002211805.1.94683 WP_002211805.1.95746 WP_002211805.1.95981 WP_002211805.1.97245 WP_002211805.1.97375 WP_002211805.1.97448 WP_002211805.1.97791 WP_002211805.1.97864 WP_002211805.1.97872 WP_002211805.1.97894 WP_002211805.1.99109 WP_002211805.1.99383 WP_002211805.1.9941 WP_002211805.1.99416 WP_002211805.1.99788 WP_002211805.1.99882 WP_002211805.1.99990 YP_002347365.1.25044 gi|170024090|ref|YP_001720595.1| 214092.YPO2400 360102.YPA_1745 377628.YPN_1855 386656.YPDSF_0748 502800.YPK_1851 gi|294503596|ref|YP_003567658.1| gi|384139773|ref|YP_005522475.1| gi|218929490|ref|YP_002347365.1| gi|384125956|ref|YP_005508570.1| gi|384414551|ref|YP_005623913.1| gi|108812017|ref|YP_647784.1| gi|145598051|ref|YP_001162127.1| gi|108807740|ref|YP_651656.1| gi|384122042|ref|YP_005504662.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]