SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384122148|ref|YP_005504768.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384122148|ref|YP_005504768.1|
Domain Number 1 Region: 235-369
Classification Level Classification E-value
Superfamily CBS-domain pair 3.16e-24
Family CBS-domain pair 0.0041
Further Details:      
 
Domain Number 2 Region: 380-462
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 8.72e-18
Family CorC/HlyC domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384122148|ref|YP_005504768.1|
Sequence length 464
Comment hypothetical protein YPD4_1557 [Yersinia pestis D106004]
Sequence
MFWALIMRLGLLSVISWMVTLTTPLFSVGAFNFAGRDLILLVGGLFLLFKATTELHERLE
GNQHNDGANRGYASFWAVVVQIVILDAVFSLDAVITAVGMVNDLPIMMTAVVIAMGVMLL
ASKSLTRFVNEHPTVVVLCLSFLLMIGLSLIAEGFGFHIPKGYLYAAIGFSILIELFNQI
ARRNFIKHESRLPRRQRTAEAIIRLMGGRQQQEQQSGDPQQAVPTEAFAEEERYMISGVL
TLASRSLRSVMTPRTEISWVDCNRSQAEIREQLLDTPHSLFPVCRDSLDQIIGVVRAKDL
LVAIERGESICDFAATTPPIVVPDTMDVINLLGVLRKAKGRLVVVNDEFGVVQGLVTPLD
VLEAIAGEFPDEDETPDIIADGDGWLVKGGADLHSLEQALDCQTLVSPTADYASLAGLLL
SHSGHMPTAGDVIELHNLRFQIMDVSDYRIELVRITKLSNELEE
Download sequence
Identical sequences A0A0H2Y714 Q0WG30 Q7CHV3
gi|108807127|ref|YP_651043.1| 187410.y2549 214092.YPO1759 360102.YPA_1131 gi|384415005|ref|YP_005624367.1| gi|294504069|ref|YP_003568131.1| gi|22126430|ref|NP_669853.1| gi|384122148|ref|YP_005504768.1| gi|384126455|ref|YP_005509069.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]