SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384122294|ref|YP_005504914.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384122294|ref|YP_005504914.1|
Domain Number 1 Region: 7-385
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.98e-84
Family AAT-like 0.00000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384122294|ref|YP_005504914.1|
Sequence length 386
Comment putative aminotransferase [Yersinia pestis D106004]
Sequence
MNKIITDQRHQFSSRVNDLHPSPIREILSVIDRPGMISFAGGLPAVESFPHMSLEGMPQP
MLQYGASEGELELRQQIAQNLCERGLSCTEEQVLIISGSQQGIDLVAKLFIDEGTPVAVE
SPTYLAALQVFRFFGAQFVAYDSTQPDIDKLRTEKPAFAYTIPTFQNPSGHCLDTEQREL
LAKTCDDIMLPLFEDDPYHDLVYDPCERKPVCASLQRASWIYQGSFSKSLSPALRLGYLV
ASSELIPYLTRLKQAADLHSSRISQWLVLQQLRSPRHTEHMHELAAYYRTRRDAFEISLQ
RHFGSLATWKKPAGGLFFWLTLNRCIDTRQLLPKALASNIAFMPGESFLPHSSEGCGQLR
LNFSHATEEQADVGLKILAGLVQEHA
Download sequence
Identical sequences A0A0E1NQS7 A0A0M1V2Q2 A0A0U1EQ57 A0A0U1R0H3 A0A208SAA0 A0A2A7VFY2 Q66B46 Q9ZC46
gi|384126307|ref|YP_005508921.1| 214092.YPO1936 273123.YPTB1934 349746.YpAngola_A2126 349747.YpsIP31758_2148 360102.YPA_1318 386656.YPDSF_1188 502801.YPTS_1983 gi|384122294|ref|YP_005504914.1| gi|186895294|ref|YP_001872406.1| WP_002212060.1.100083 WP_002212060.1.10066 WP_002212060.1.100931 WP_002212060.1.10105 WP_002212060.1.101305 WP_002212060.1.101382 WP_002212060.1.101928 WP_002212060.1.10736 WP_002212060.1.10935 WP_002212060.1.11693 WP_002212060.1.12167 WP_002212060.1.12463 WP_002212060.1.12736 WP_002212060.1.12857 WP_002212060.1.1388 WP_002212060.1.14063 WP_002212060.1.14169 WP_002212060.1.14804 WP_002212060.1.15321 WP_002212060.1.15555 WP_002212060.1.15605 WP_002212060.1.15689 WP_002212060.1.16243 WP_002212060.1.17135 WP_002212060.1.17141 WP_002212060.1.17608 WP_002212060.1.17873 WP_002212060.1.17983 WP_002212060.1.18208 WP_002212060.1.18640 WP_002212060.1.18826 WP_002212060.1.19329 WP_002212060.1.19425 WP_002212060.1.19739 WP_002212060.1.19763 WP_002212060.1.20035 WP_002212060.1.20380 WP_002212060.1.20547 WP_002212060.1.20932 WP_002212060.1.21486 WP_002212060.1.21784 WP_002212060.1.21879 WP_002212060.1.23271 WP_002212060.1.23687 WP_002212060.1.23811 WP_002212060.1.2451 WP_002212060.1.24517 WP_002212060.1.25181 WP_002212060.1.25394 WP_002212060.1.26383 WP_002212060.1.2640 WP_002212060.1.26960 WP_002212060.1.27124 WP_002212060.1.27251 WP_002212060.1.2726 WP_002212060.1.28922 WP_002212060.1.29157 WP_002212060.1.29355 WP_002212060.1.2947 WP_002212060.1.29622 WP_002212060.1.2964 WP_002212060.1.29685 WP_002212060.1.29814 WP_002212060.1.3092 WP_002212060.1.30931 WP_002212060.1.311 WP_002212060.1.31336 WP_002212060.1.31496 WP_002212060.1.31739 WP_002212060.1.32343 WP_002212060.1.32388 WP_002212060.1.32736 WP_002212060.1.33203 WP_002212060.1.33324 WP_002212060.1.33661 WP_002212060.1.33937 WP_002212060.1.34031 WP_002212060.1.34138 WP_002212060.1.35389 WP_002212060.1.35538 WP_002212060.1.36088 WP_002212060.1.37174 WP_002212060.1.37494 WP_002212060.1.37863 WP_002212060.1.38147 WP_002212060.1.38235 WP_002212060.1.38532 WP_002212060.1.38743 WP_002212060.1.38824 WP_002212060.1.38993 WP_002212060.1.39346 WP_002212060.1.3976 WP_002212060.1.39858 WP_002212060.1.40071 WP_002212060.1.40134 WP_002212060.1.40534 WP_002212060.1.41196 WP_002212060.1.41984 WP_002212060.1.4210 WP_002212060.1.42361 WP_002212060.1.42490 WP_002212060.1.42976 WP_002212060.1.44408 WP_002212060.1.44832 WP_002212060.1.45198 WP_002212060.1.45214 WP_002212060.1.46545 WP_002212060.1.46686 WP_002212060.1.46697 WP_002212060.1.46731 WP_002212060.1.4678 WP_002212060.1.46891 WP_002212060.1.47387 WP_002212060.1.47440 WP_002212060.1.47769 WP_002212060.1.47881 WP_002212060.1.48166 WP_002212060.1.49315 WP_002212060.1.49906 WP_002212060.1.4997 WP_002212060.1.50093 WP_002212060.1.50106 WP_002212060.1.50185 WP_002212060.1.51284 WP_002212060.1.51293 WP_002212060.1.51772 WP_002212060.1.51934 WP_002212060.1.52158 WP_002212060.1.52247 WP_002212060.1.52473 WP_002212060.1.52734 WP_002212060.1.52819 WP_002212060.1.52969 WP_002212060.1.53147 WP_002212060.1.53300 WP_002212060.1.53838 WP_002212060.1.53883 WP_002212060.1.53953 WP_002212060.1.54568 WP_002212060.1.54951 WP_002212060.1.55194 WP_002212060.1.5592 WP_002212060.1.56031 WP_002212060.1.56912 WP_002212060.1.57585 WP_002212060.1.57657 WP_002212060.1.58067 WP_002212060.1.58543 WP_002212060.1.59102 WP_002212060.1.59431 WP_002212060.1.5957 WP_002212060.1.59687 WP_002212060.1.59789 WP_002212060.1.59885 WP_002212060.1.60437 WP_002212060.1.60707 WP_002212060.1.60896 WP_002212060.1.62232 WP_002212060.1.62342 WP_002212060.1.6270 WP_002212060.1.6333 WP_002212060.1.63387 WP_002212060.1.63641 WP_002212060.1.64142 WP_002212060.1.64474 WP_002212060.1.64780 WP_002212060.1.64786 WP_002212060.1.64910 WP_002212060.1.65400 WP_002212060.1.65554 WP_002212060.1.6570 WP_002212060.1.65718 WP_002212060.1.6581 WP_002212060.1.66546 WP_002212060.1.66616 WP_002212060.1.67404 WP_002212060.1.67850 WP_002212060.1.6791 WP_002212060.1.68361 WP_002212060.1.68371 WP_002212060.1.68753 WP_002212060.1.70117 WP_002212060.1.70171 WP_002212060.1.70319 WP_002212060.1.70377 WP_002212060.1.70417 WP_002212060.1.70726 WP_002212060.1.7083 WP_002212060.1.7169 WP_002212060.1.71744 WP_002212060.1.72280 WP_002212060.1.72440 WP_002212060.1.72486 WP_002212060.1.7402 WP_002212060.1.74131 WP_002212060.1.74310 WP_002212060.1.74738 WP_002212060.1.75173 WP_002212060.1.7518 WP_002212060.1.75208 WP_002212060.1.75636 WP_002212060.1.75689 WP_002212060.1.75821 WP_002212060.1.76555 WP_002212060.1.76670 WP_002212060.1.77387 WP_002212060.1.77429 WP_002212060.1.77691 WP_002212060.1.78004 WP_002212060.1.7841 WP_002212060.1.78556 WP_002212060.1.79515 WP_002212060.1.79550 WP_002212060.1.79609 WP_002212060.1.79981 WP_002212060.1.8009 WP_002212060.1.80331 WP_002212060.1.81848 WP_002212060.1.81877 WP_002212060.1.8210 WP_002212060.1.82133 WP_002212060.1.82151 WP_002212060.1.82270 WP_002212060.1.82436 WP_002212060.1.82619 WP_002212060.1.83039 WP_002212060.1.83265 WP_002212060.1.83630 WP_002212060.1.8420 WP_002212060.1.84720 WP_002212060.1.85270 WP_002212060.1.8559 WP_002212060.1.85802 WP_002212060.1.86034 WP_002212060.1.86059 WP_002212060.1.86413 WP_002212060.1.87107 WP_002212060.1.8728 WP_002212060.1.87418 WP_002212060.1.8762 WP_002212060.1.87853 WP_002212060.1.89359 WP_002212060.1.89542 WP_002212060.1.8964 WP_002212060.1.9051 WP_002212060.1.90624 WP_002212060.1.91263 WP_002212060.1.91373 WP_002212060.1.91844 WP_002212060.1.92030 WP_002212060.1.92604 WP_002212060.1.927 WP_002212060.1.9320 WP_002212060.1.93623 WP_002212060.1.93928 WP_002212060.1.93933 WP_002212060.1.94201 WP_002212060.1.94545 WP_002212060.1.94683 WP_002212060.1.95746 WP_002212060.1.95981 WP_002212060.1.97375 WP_002212060.1.97448 WP_002212060.1.97791 WP_002212060.1.97864 WP_002212060.1.97872 WP_002212060.1.97894 WP_002212060.1.99416 WP_002212060.1.99990 YP_002346925.1.25044 gi|108807314|ref|YP_651230.1| gi|162420764|ref|YP_001606580.1| gi|153949662|ref|YP_001401121.1| gi|145598481|ref|YP_001162557.1| gi|51596260|ref|YP_070451.1| gi|218929050|ref|YP_002346925.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]