SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384122318|ref|YP_005504938.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384122318|ref|YP_005504938.1|
Domain Number 1 Region: 48-434
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.95e-124
Family GABA-aminotransferase-like 0.000000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384122318|ref|YP_005504938.1|
Sequence length 446
Comment bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein [Yersinia pestis D106004]
Sequence
MVNRISDFCWGAEIHSDDEFLNLLFTLIKGGNMEQPSPVTRQSFDEWIVPTYAPADFIVV
RGEGSTLWDQQGKSYIDFAGGIAVNALGHGHPAVRAALIEQADKVWHLGNGYTNEPVLRL
AKQLIDATFAEKVFFCNSGAEANEAALKLARKYALDNFANKAGQQGEKNQIVAFRNAFHG
RTLFTVSAGGQPKYSQDFAPLPGGIHHGIFNDLASAEHLITDQTCAVIVEPIQGEGGVLP
ADKEFLHGLRALCDRHNALLIFDEIQTGVGRTGELYAYMHYGVSPDVLTSAKALGGGFPI
GAMLTTTKYASALSVGSHGTTFGGNPLACAVAGTVLSLINQPTLLAGVKARHQWFIDELA
EINARHNVFAEIRGRGLLIGCVLNAQYAGKSKEIVQAAAQYGLIALIAGPDVVRFAPSLI
ISPKEIKEGLARLAMGIEQVCQKVTS
Download sequence
Identical sequences A0A0H3B3M1 A0A0M1V3B3
386656.YPDSF_1161 502800.YPK_2229 502801.YPTS_2011 gi|384126283|ref|YP_005508897.1| gi|186895322|ref|YP_001872434.1| gi|384122318|ref|YP_005504938.1| gi|145598456|ref|YP_001162532.1| gi|170024458|ref|YP_001720963.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]