SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384122471|ref|YP_005505091.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384122471|ref|YP_005505091.1|
Domain Number 1 Region: 3-381
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.29e-98
Family Cystathionine synthase-like 0.0000000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384122471|ref|YP_005505091.1|
Sequence length 399
Comment putative aminotransferase [Yersinia pestis D106004]
Sequence
MYSQNPPIYLDNNATTALDPAVLQAMMPYLTHAYGNAASKSHPFGWEASQAVQRARTLIA
TAINAVSPADIIFTSGATESINLAILGLQYQGNWGHIITSMIEHKSVLDCCAKLADSGVS
VTYLQPQRDGIVSLDTLFQAIRPDTRLVSIMTANNETGTLQKVAEIGALCRDKGILFHTD
ATQAFGKIALDMQRMNISMATFSAHKVYGPMGVGALYVNTADPHLMLSPLIVGGGHERGL
RSGTLNVPGIVGFGRAAELAMENMSVESARLCDLRNRLRQHILDTVPNVQVNGHLTECLP
GVLNVSFEGIDADSLLLELSDVALSSGSACTSDQQIPSHVLQALGASDEQIRGSVRFGLG
RFNNESEIDYVCQRLENTVKTLRSMAPLSSATTTNETGV
Download sequence
Identical sequences A0A0E1NTV9 A0A0H2W404 A0A0H2YI95 A0A0M1V3N5 A0A208S0B1 Q7CIG5
WP_002211693.1.100083 WP_002211693.1.100246 WP_002211693.1.10066 WP_002211693.1.100921 WP_002211693.1.100931 WP_002211693.1.10105 WP_002211693.1.101305 WP_002211693.1.101382 WP_002211693.1.101928 WP_002211693.1.102012 WP_002211693.1.102067 WP_002211693.1.10736 WP_002211693.1.10935 WP_002211693.1.10955 WP_002211693.1.11693 WP_002211693.1.12463 WP_002211693.1.12736 WP_002211693.1.12857 WP_002211693.1.1388 WP_002211693.1.14063 WP_002211693.1.14804 WP_002211693.1.15321 WP_002211693.1.15555 WP_002211693.1.15605 WP_002211693.1.15689 WP_002211693.1.16243 WP_002211693.1.16333 WP_002211693.1.17135 WP_002211693.1.17141 WP_002211693.1.17608 WP_002211693.1.17873 WP_002211693.1.17983 WP_002211693.1.18208 WP_002211693.1.18640 WP_002211693.1.18826 WP_002211693.1.19329 WP_002211693.1.19425 WP_002211693.1.19739 WP_002211693.1.19763 WP_002211693.1.20035 WP_002211693.1.2064 WP_002211693.1.21486 WP_002211693.1.21784 WP_002211693.1.21879 WP_002211693.1.21934 WP_002211693.1.22530 WP_002211693.1.22542 WP_002211693.1.22708 WP_002211693.1.23157 WP_002211693.1.23271 WP_002211693.1.23687 WP_002211693.1.23811 WP_002211693.1.24002 WP_002211693.1.2451 WP_002211693.1.24517 WP_002211693.1.25181 WP_002211693.1.25394 WP_002211693.1.2640 WP_002211693.1.26776 WP_002211693.1.26960 WP_002211693.1.27124 WP_002211693.1.27251 WP_002211693.1.2726 WP_002211693.1.28647 WP_002211693.1.28922 WP_002211693.1.29157 WP_002211693.1.29355 WP_002211693.1.2947 WP_002211693.1.29622 WP_002211693.1.2964 WP_002211693.1.29685 WP_002211693.1.29814 WP_002211693.1.3092 WP_002211693.1.30931 WP_002211693.1.311 WP_002211693.1.31336 WP_002211693.1.31496 WP_002211693.1.31739 WP_002211693.1.31805 WP_002211693.1.32343 WP_002211693.1.32388 WP_002211693.1.32446 WP_002211693.1.33203 WP_002211693.1.33937 WP_002211693.1.34031 WP_002211693.1.34138 WP_002211693.1.35389 WP_002211693.1.35538 WP_002211693.1.36088 WP_002211693.1.37174 WP_002211693.1.37494 WP_002211693.1.37863 WP_002211693.1.38147 WP_002211693.1.38235 WP_002211693.1.38743 WP_002211693.1.38824 WP_002211693.1.38993 WP_002211693.1.39066 WP_002211693.1.39346 WP_002211693.1.3976 WP_002211693.1.40071 WP_002211693.1.40134 WP_002211693.1.40534 WP_002211693.1.40853 WP_002211693.1.41196 WP_002211693.1.4210 WP_002211693.1.42490 WP_002211693.1.44408 WP_002211693.1.44603 WP_002211693.1.44832 WP_002211693.1.45198 WP_002211693.1.45214 WP_002211693.1.46262 WP_002211693.1.46545 WP_002211693.1.46686 WP_002211693.1.46731 WP_002211693.1.4678 WP_002211693.1.46891 WP_002211693.1.47387 WP_002211693.1.47440 WP_002211693.1.47881 WP_002211693.1.48166 WP_002211693.1.48722 WP_002211693.1.4889 WP_002211693.1.49906 WP_002211693.1.4997 WP_002211693.1.50010 WP_002211693.1.50093 WP_002211693.1.50106 WP_002211693.1.50984 WP_002211693.1.51284 WP_002211693.1.51293 WP_002211693.1.51588 WP_002211693.1.51772 WP_002211693.1.51934 WP_002211693.1.52158 WP_002211693.1.52247 WP_002211693.1.52734 WP_002211693.1.52819 WP_002211693.1.52969 WP_002211693.1.53147 WP_002211693.1.53300 WP_002211693.1.53838 WP_002211693.1.53848 WP_002211693.1.53953 WP_002211693.1.54568 WP_002211693.1.54951 WP_002211693.1.55194 WP_002211693.1.55695 WP_002211693.1.56031 WP_002211693.1.56912 WP_002211693.1.56953 WP_002211693.1.57585 WP_002211693.1.57657 WP_002211693.1.58067 WP_002211693.1.58794 WP_002211693.1.59102 WP_002211693.1.59431 WP_002211693.1.5957 WP_002211693.1.59635 WP_002211693.1.59687 WP_002211693.1.59789 WP_002211693.1.59885 WP_002211693.1.60437 WP_002211693.1.60707 WP_002211693.1.60896 WP_002211693.1.61689 WP_002211693.1.62232 WP_002211693.1.62342 WP_002211693.1.64142 WP_002211693.1.64474 WP_002211693.1.64786 WP_002211693.1.64910 WP_002211693.1.653 WP_002211693.1.65400 WP_002211693.1.65554 WP_002211693.1.6570 WP_002211693.1.65706 WP_002211693.1.65718 WP_002211693.1.6581 WP_002211693.1.66118 WP_002211693.1.66546 WP_002211693.1.66616 WP_002211693.1.67404 WP_002211693.1.67850 WP_002211693.1.68361 WP_002211693.1.68753 WP_002211693.1.68855 WP_002211693.1.69018 WP_002211693.1.69316 WP_002211693.1.69951 WP_002211693.1.70117 WP_002211693.1.70171 WP_002211693.1.70319 WP_002211693.1.7083 WP_002211693.1.7169 WP_002211693.1.71744 WP_002211693.1.72280 WP_002211693.1.72440 WP_002211693.1.72486 WP_002211693.1.7402 WP_002211693.1.74131 WP_002211693.1.74310 WP_002211693.1.74577 WP_002211693.1.74738 WP_002211693.1.75173 WP_002211693.1.7518 WP_002211693.1.75337 WP_002211693.1.75407 WP_002211693.1.75636 WP_002211693.1.75689 WP_002211693.1.75821 WP_002211693.1.76670 WP_002211693.1.77387 WP_002211693.1.77429 WP_002211693.1.77691 WP_002211693.1.78004 WP_002211693.1.7841 WP_002211693.1.78556 WP_002211693.1.79515 WP_002211693.1.79550 WP_002211693.1.79609 WP_002211693.1.79981 WP_002211693.1.8009 WP_002211693.1.80331 WP_002211693.1.81848 WP_002211693.1.81877 WP_002211693.1.8210 WP_002211693.1.82133 WP_002211693.1.82151 WP_002211693.1.82270 WP_002211693.1.82619 WP_002211693.1.8303 WP_002211693.1.83039 WP_002211693.1.83265 WP_002211693.1.8420 WP_002211693.1.84703 WP_002211693.1.84720 WP_002211693.1.85269 WP_002211693.1.85270 WP_002211693.1.8559 WP_002211693.1.85802 WP_002211693.1.86034 WP_002211693.1.86059 WP_002211693.1.86413 WP_002211693.1.87107 WP_002211693.1.87418 WP_002211693.1.8762 WP_002211693.1.87988 WP_002211693.1.88362 WP_002211693.1.88472 WP_002211693.1.89359 WP_002211693.1.8964 WP_002211693.1.90176 WP_002211693.1.9051 WP_002211693.1.90624 WP_002211693.1.91373 WP_002211693.1.91844 WP_002211693.1.92030 WP_002211693.1.92331 WP_002211693.1.92604 WP_002211693.1.927 WP_002211693.1.9311 WP_002211693.1.9320 WP_002211693.1.93623 WP_002211693.1.93928 WP_002211693.1.93933 WP_002211693.1.94052 WP_002211693.1.94201 WP_002211693.1.94545 WP_002211693.1.94683 WP_002211693.1.95746 WP_002211693.1.97245 WP_002211693.1.97375 WP_002211693.1.97448 WP_002211693.1.97791 WP_002211693.1.97864 WP_002211693.1.97894 WP_002211693.1.99109 WP_002211693.1.99383 WP_002211693.1.9941 WP_002211693.1.99416 WP_002211693.1.99788 WP_002211693.1.99990 YP_002347116.1.25044 187410.y2182 214092.YPO2138 229193.YP_1941 349746.YpAngola_A2368 360102.YPA_1498 377628.YPN_1607 386656.YPDSF_0993 gi|145598290|ref|YP_001162366.1| gi|162419502|ref|YP_001606795.1| gi|22126069|ref|NP_669492.1| gi|294503813|ref|YP_003567875.1| gi|384122471|ref|YP_005505091.1| gi|218929241|ref|YP_002347116.1| gi|384140031|ref|YP_005522733.1| gi|384414679|ref|YP_005624041.1| gi|108811770|ref|YP_647537.1| gi|384126130|ref|YP_005508744.1| gi|45441742|ref|NP_993281.1| gi|108807494|ref|YP_651410.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]