SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384122820|ref|YP_005505440.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384122820|ref|YP_005505440.1|
Domain Number 1 Region: 23-427
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.86e-122
Family GABA-aminotransferase-like 0.0000000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384122820|ref|YP_005505440.1|
Sequence length 429
Comment 4-aminobutyrate aminotransferase [Yersinia pestis D106004]
Sequence
MSHRELEQRRKEATPRGIGVLCDFYAVRAENATLWDEQGREYIDFTAGIATLNIGHRHPK
VMAAVRQQLDQFTHTAYQVVPYASYVTLAEKINSLAPISDSNMTAAGNSKTAFFTTGVEA
IENAVKIARAATGRPGVIAFSGAFHGRTLLAMALTGRAVPYKVGFGPFPASIFHALYPNE
LYGVSVEEAISSVERLFRCDISPTQVAAILFEPIQGEGGFNIAPPEFVSALRTLCDEHGI
LLIADEVQTGFARTGKLFAMEYYPDTKVDVITMAKSLGGGMPISAVTGRADIMDAPLPGS
LGGTYAGNPLAVAASLAVLDIIAEEKLCERALILGAKLVDVLEKAQMSNAAIVGIRARGS
MVAVEFNDPVSGKPSPELTRAYQRQALEEGLLLLSCGVHSNVIRFLYPLTIPDKQFKQAM
NILTRLLAS
Download sequence
Identical sequences A0A0E1NRB9 A0A0M1VAA7 Q0WD56
gi|384139257|ref|YP_005521959.1| gi|294504589|ref|YP_003568651.1| gi|384413846|ref|YP_005623208.1| gi|384122820|ref|YP_005505440.1| 349746.YpAngola_A3106 gi|162419701|ref|YP_001607470.1| WP_002209789.1.66118 gi|384126911|ref|YP_005509525.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]