SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384122878|ref|YP_005505498.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384122878|ref|YP_005505498.1|
Domain Number 1 Region: 6-416
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.99e-180
Family GABA-aminotransferase-like 0.00000000000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384122878|ref|YP_005505498.1|
Sequence length 417
Comment serine hydroxymethyltransferase [Yersinia pestis D106004]
Sequence
MLKREMNIADYDADLWRAMEQEVVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYP
GKRYYGGCEYVDVVEQLAIDRAKALFGADYANVQPHSGSQANVAVYSALLKPGDTVLGMN
LAHGGHLTHGSPVNFSGKLYNIVPYGIDESGQIDYEDLARQAEIHKPKMIIGGFSAYSGI
VDWAKMREIADSIDAWFFVDMAHVAGLVAAGVYPNPVPHAHIVTTTTHKTLAGPRGGLIL
AKGGDEDLYKKLNSSVFPGNQGGPLMHVIAGKAVALKEAMEPEFKIYQQQVAKNAKAMVA
VFLERGYKVVSGGTDNHLFLLDLVDKDITGKDADAALGRANITVNKNSVPNDPKSPFVTS
GVRIGSPAITRRGFKEAESRELAGWMCDVLDNINDEATIERVKQKVLAICARLPVYA
Download sequence
Identical sequences A0A0E1NVF6 A0A0E8XEB1 A0A0M1V4R9 A0A0U1EUT6 A0A154M8Q6 A0A208RSF0 A0A2A7VI85 A4TMW4 A9R8C1 B1JRX7 B2K9S8 Q1C5G0 Q1CKB8 Q667X1 Q8ZCR1
gi|294504534|ref|YP_003568596.1| gi|51597185|ref|YP_071376.1| gi|170023511|ref|YP_001720016.1| gi|108811395|ref|YP_647162.1| gi|384139323|ref|YP_005522025.1| WP_002211552.1.100083 WP_002211552.1.100246 WP_002211552.1.100593 WP_002211552.1.10066 WP_002211552.1.100921 WP_002211552.1.100931 WP_002211552.1.10105 WP_002211552.1.101305 WP_002211552.1.101382 WP_002211552.1.101928 WP_002211552.1.102012 WP_002211552.1.102067 WP_002211552.1.10736 WP_002211552.1.10935 WP_002211552.1.10955 WP_002211552.1.11693 WP_002211552.1.12167 WP_002211552.1.12463 WP_002211552.1.12736 WP_002211552.1.12857 WP_002211552.1.1388 WP_002211552.1.14063 WP_002211552.1.15321 WP_002211552.1.15555 WP_002211552.1.15605 WP_002211552.1.15689 WP_002211552.1.16243 WP_002211552.1.16333 WP_002211552.1.17135 WP_002211552.1.17141 WP_002211552.1.17608 WP_002211552.1.17873 WP_002211552.1.17983 WP_002211552.1.18208 WP_002211552.1.18640 WP_002211552.1.18826 WP_002211552.1.19329 WP_002211552.1.19425 WP_002211552.1.19739 WP_002211552.1.20035 WP_002211552.1.20380 WP_002211552.1.20547 WP_002211552.1.2064 WP_002211552.1.20932 WP_002211552.1.21486 WP_002211552.1.21784 WP_002211552.1.21879 WP_002211552.1.21934 WP_002211552.1.22530 WP_002211552.1.22542 WP_002211552.1.22708 WP_002211552.1.23157 WP_002211552.1.23271 WP_002211552.1.23687 WP_002211552.1.23811 WP_002211552.1.24002 WP_002211552.1.2451 WP_002211552.1.24517 WP_002211552.1.25181 WP_002211552.1.25394 WP_002211552.1.26383 WP_002211552.1.2640 WP_002211552.1.26509 WP_002211552.1.26776 WP_002211552.1.26960 WP_002211552.1.27124 WP_002211552.1.27251 WP_002211552.1.2726 WP_002211552.1.28647 WP_002211552.1.28922 WP_002211552.1.29157 WP_002211552.1.29186 WP_002211552.1.29355 WP_002211552.1.2947 WP_002211552.1.29622 WP_002211552.1.2964 WP_002211552.1.29685 WP_002211552.1.29814 WP_002211552.1.3092 WP_002211552.1.30931 WP_002211552.1.311 WP_002211552.1.31336 WP_002211552.1.31496 WP_002211552.1.31721 WP_002211552.1.31739 WP_002211552.1.31805 WP_002211552.1.32343 WP_002211552.1.32388 WP_002211552.1.32446 WP_002211552.1.32736 WP_002211552.1.33203 WP_002211552.1.33324 WP_002211552.1.33661 WP_002211552.1.33775 WP_002211552.1.33937 WP_002211552.1.34031 WP_002211552.1.34138 WP_002211552.1.35389 WP_002211552.1.35538 WP_002211552.1.36088 WP_002211552.1.37174 WP_002211552.1.37494 WP_002211552.1.37863 WP_002211552.1.38147 WP_002211552.1.38235 WP_002211552.1.38532 WP_002211552.1.38743 WP_002211552.1.38824 WP_002211552.1.38993 WP_002211552.1.39066 WP_002211552.1.39346 WP_002211552.1.3976 WP_002211552.1.39858 WP_002211552.1.40071 WP_002211552.1.40134 WP_002211552.1.40534 WP_002211552.1.40853 WP_002211552.1.41196 WP_002211552.1.41984 WP_002211552.1.4210 WP_002211552.1.42361 WP_002211552.1.42490 WP_002211552.1.42976 WP_002211552.1.44408 WP_002211552.1.44603 WP_002211552.1.44832 WP_002211552.1.45198 WP_002211552.1.45214 WP_002211552.1.46262 WP_002211552.1.46545 WP_002211552.1.46686 WP_002211552.1.46697 WP_002211552.1.46731 WP_002211552.1.4678 WP_002211552.1.46891 WP_002211552.1.47387 WP_002211552.1.47440 WP_002211552.1.47769 WP_002211552.1.47881 WP_002211552.1.48166 WP_002211552.1.48722 WP_002211552.1.4889 WP_002211552.1.49315 WP_002211552.1.49906 WP_002211552.1.4997 WP_002211552.1.50010 WP_002211552.1.50093 WP_002211552.1.50106 WP_002211552.1.50185 WP_002211552.1.50984 WP_002211552.1.51284 WP_002211552.1.51588 WP_002211552.1.51772 WP_002211552.1.51934 WP_002211552.1.52158 WP_002211552.1.52247 WP_002211552.1.52473 WP_002211552.1.52569 WP_002211552.1.52734 WP_002211552.1.52792 WP_002211552.1.52819 WP_002211552.1.52969 WP_002211552.1.53147 WP_002211552.1.53300 WP_002211552.1.53838 WP_002211552.1.53848 WP_002211552.1.53883 WP_002211552.1.54568 WP_002211552.1.54951 WP_002211552.1.55194 WP_002211552.1.55695 WP_002211552.1.5592 WP_002211552.1.56031 WP_002211552.1.56912 WP_002211552.1.56953 WP_002211552.1.57585 WP_002211552.1.57657 WP_002211552.1.58067 WP_002211552.1.58794 WP_002211552.1.59102 WP_002211552.1.59431 WP_002211552.1.59635 WP_002211552.1.5968 WP_002211552.1.59687 WP_002211552.1.59789 WP_002211552.1.59885 WP_002211552.1.60437 WP_002211552.1.60707 WP_002211552.1.60896 WP_002211552.1.61689 WP_002211552.1.62232 WP_002211552.1.62342 WP_002211552.1.6270 WP_002211552.1.63387 WP_002211552.1.63517 WP_002211552.1.63641 WP_002211552.1.64142 WP_002211552.1.64474 WP_002211552.1.64780 WP_002211552.1.64786 WP_002211552.1.64910 WP_002211552.1.653 WP_002211552.1.65400 WP_002211552.1.65554 WP_002211552.1.6570 WP_002211552.1.65706 WP_002211552.1.65718 WP_002211552.1.6581 WP_002211552.1.66118 WP_002211552.1.66546 WP_002211552.1.66616 WP_002211552.1.67404 WP_002211552.1.67850 WP_002211552.1.6791 WP_002211552.1.68361 WP_002211552.1.68371 WP_002211552.1.68753 WP_002211552.1.68855 WP_002211552.1.69018 WP_002211552.1.69316 WP_002211552.1.69951 WP_002211552.1.70117 WP_002211552.1.70171 WP_002211552.1.70319 WP_002211552.1.70377 WP_002211552.1.70417 WP_002211552.1.70726 WP_002211552.1.7083 WP_002211552.1.7169 WP_002211552.1.71744 WP_002211552.1.72280 WP_002211552.1.72440 WP_002211552.1.72486 WP_002211552.1.7402 WP_002211552.1.74131 WP_002211552.1.74310 WP_002211552.1.74738 WP_002211552.1.75169 WP_002211552.1.75173 WP_002211552.1.7518 WP_002211552.1.75208 WP_002211552.1.75337 WP_002211552.1.75407 WP_002211552.1.75636 WP_002211552.1.75689 WP_002211552.1.75821 WP_002211552.1.76555 WP_002211552.1.76670 WP_002211552.1.77295 WP_002211552.1.77387 WP_002211552.1.77429 WP_002211552.1.77569 WP_002211552.1.78004 WP_002211552.1.7841 WP_002211552.1.79515 WP_002211552.1.79550 WP_002211552.1.79609 WP_002211552.1.79825 WP_002211552.1.79981 WP_002211552.1.8009 WP_002211552.1.80331 WP_002211552.1.81848 WP_002211552.1.8210 WP_002211552.1.82133 WP_002211552.1.82151 WP_002211552.1.82270 WP_002211552.1.82436 WP_002211552.1.82619 WP_002211552.1.8303 WP_002211552.1.83039 WP_002211552.1.83265 WP_002211552.1.83630 WP_002211552.1.84703 WP_002211552.1.85269 WP_002211552.1.85270 WP_002211552.1.8559 WP_002211552.1.85802 WP_002211552.1.86034 WP_002211552.1.86059 WP_002211552.1.86413 WP_002211552.1.87107 WP_002211552.1.8728 WP_002211552.1.87418 WP_002211552.1.8762 WP_002211552.1.87853 WP_002211552.1.87988 WP_002211552.1.88362 WP_002211552.1.88472 WP_002211552.1.89359 WP_002211552.1.89542 WP_002211552.1.8964 WP_002211552.1.90176 WP_002211552.1.9051 WP_002211552.1.90624 WP_002211552.1.91373 WP_002211552.1.91844 WP_002211552.1.92030 WP_002211552.1.92331 WP_002211552.1.92604 WP_002211552.1.927 WP_002211552.1.9311 WP_002211552.1.93623 WP_002211552.1.93928 WP_002211552.1.93933 WP_002211552.1.94052 WP_002211552.1.94201 WP_002211552.1.94545 WP_002211552.1.94683 WP_002211552.1.95746 WP_002211552.1.95981 WP_002211552.1.97245 WP_002211552.1.97375 WP_002211552.1.97448 WP_002211552.1.97864 WP_002211552.1.97872 WP_002211552.1.97894 WP_002211552.1.99109 WP_002211552.1.99383 WP_002211552.1.9941 WP_002211552.1.99416 WP_002211552.1.99882 WP_002211552.1.99972 WP_002211552.1.99990 YP_002347841.1.25044 gi|145599523|ref|YP_001163599.1| gi|45442328|ref|NP_993867.1| gi|22125221|ref|NP_668644.1| gi|384126858|ref|YP_005509472.1| gi|384415547|ref|YP_005624909.1| gi|108808341|ref|YP_652257.1| gi|186896280|ref|YP_001873392.1| gi|162418607|ref|YP_001605050.1| gi|384122878|ref|YP_005505498.1| gi|218929966|ref|YP_002347841.1| 187410.y1322 214092.YPO2907 229193.YP_2548 273123.YPTB2869 349746.YpAngola_A0445 360102.YPA_2347 377628.YPN_1232 386656.YPDSF_2251 502800.YPK_1265 502801.YPTS_2978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]