SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384123044|ref|YP_005505664.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384123044|ref|YP_005505664.1|
Domain Number 1 Region: 7-401
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.26e-95
Family AAT-like 0.00000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384123044|ref|YP_005505664.1|
Sequence length 404
Comment aspartate aminotransferase [Yersinia pestis D106004]
Sequence
MSPIEKSSKLDNVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLFSARKAIMQHYQARNIRDLTVEDIYIGNGVSELIVQSMQALLNLGD
EMLVPAPDYPLWTAAVSLSSGKAIHYMCDEESGWFPDLDDIRSKITPRTRGIVIINPNNP
TGAVYSKELLLEIVEIARQNDLIIFADEIYDKILYDDAQHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPMQHAIQTALGGYQSISEFI
QPGGRLYEQRDRAWELINQIPGVSCVKPQGALYMFPRIDQKRFNLKDDQKLVLDLLLQEK
VLLVQGSAFNWPYPDHVRIVTLPRVDELEMAVRKLGRFLETYHQ
Download sequence
Identical sequences A0A0E1NZI6 A0A0H2YHW0 A0A0M1V8M0 A0A208S4Q0 Q0WDW9
gi|384414099|ref|YP_005623461.1| gi|161484830|ref|NP_668946.2| 187410.y1628 214092.YPO2558 229193.YP_2369 349746.YpAngola_A1819 360102.YPA_2049 377628.YPN_2152 gi|384139612|ref|YP_005522314.1| gi|384123044|ref|YP_005505664.1| gi|108808044|ref|YP_651960.1| WP_002210282.1.100083 WP_002210282.1.100246 WP_002210282.1.100921 WP_002210282.1.100931 WP_002210282.1.10105 WP_002210282.1.101305 WP_002210282.1.101382 WP_002210282.1.101928 WP_002210282.1.102012 WP_002210282.1.102067 WP_002210282.1.10736 WP_002210282.1.10935 WP_002210282.1.10955 WP_002210282.1.11693 WP_002210282.1.12463 WP_002210282.1.12736 WP_002210282.1.12857 WP_002210282.1.1388 WP_002210282.1.14063 WP_002210282.1.14804 WP_002210282.1.15321 WP_002210282.1.15555 WP_002210282.1.15605 WP_002210282.1.15689 WP_002210282.1.16243 WP_002210282.1.16333 WP_002210282.1.17135 WP_002210282.1.17141 WP_002210282.1.17873 WP_002210282.1.17983 WP_002210282.1.18208 WP_002210282.1.18640 WP_002210282.1.18826 WP_002210282.1.19425 WP_002210282.1.19739 WP_002210282.1.19763 WP_002210282.1.20035 WP_002210282.1.2064 WP_002210282.1.21486 WP_002210282.1.21784 WP_002210282.1.21879 WP_002210282.1.21934 WP_002210282.1.22530 WP_002210282.1.22542 WP_002210282.1.22708 WP_002210282.1.23157 WP_002210282.1.23271 WP_002210282.1.23811 WP_002210282.1.24002 WP_002210282.1.2451 WP_002210282.1.25394 WP_002210282.1.2640 WP_002210282.1.26776 WP_002210282.1.26960 WP_002210282.1.27124 WP_002210282.1.27251 WP_002210282.1.2726 WP_002210282.1.28647 WP_002210282.1.28922 WP_002210282.1.29157 WP_002210282.1.29355 WP_002210282.1.2947 WP_002210282.1.2964 WP_002210282.1.29814 WP_002210282.1.3092 WP_002210282.1.30931 WP_002210282.1.311 WP_002210282.1.31336 WP_002210282.1.31496 WP_002210282.1.31739 WP_002210282.1.31805 WP_002210282.1.32343 WP_002210282.1.32388 WP_002210282.1.32446 WP_002210282.1.33203 WP_002210282.1.33661 WP_002210282.1.33937 WP_002210282.1.34031 WP_002210282.1.34138 WP_002210282.1.35389 WP_002210282.1.35538 WP_002210282.1.36088 WP_002210282.1.37174 WP_002210282.1.37863 WP_002210282.1.38147 WP_002210282.1.38235 WP_002210282.1.38743 WP_002210282.1.38824 WP_002210282.1.38993 WP_002210282.1.39066 WP_002210282.1.39346 WP_002210282.1.3976 WP_002210282.1.40071 WP_002210282.1.40134 WP_002210282.1.40853 WP_002210282.1.41196 WP_002210282.1.4210 WP_002210282.1.42490 WP_002210282.1.44408 WP_002210282.1.44598 WP_002210282.1.44603 WP_002210282.1.44832 WP_002210282.1.45198 WP_002210282.1.45214 WP_002210282.1.46262 WP_002210282.1.46545 WP_002210282.1.46686 WP_002210282.1.4678 WP_002210282.1.46891 WP_002210282.1.47387 WP_002210282.1.47440 WP_002210282.1.48166 WP_002210282.1.48722 WP_002210282.1.4889 WP_002210282.1.49906 WP_002210282.1.4997 WP_002210282.1.50010 WP_002210282.1.50093 WP_002210282.1.50106 WP_002210282.1.50984 WP_002210282.1.51293 WP_002210282.1.51588 WP_002210282.1.51772 WP_002210282.1.51934 WP_002210282.1.52158 WP_002210282.1.52247 WP_002210282.1.52734 WP_002210282.1.52819 WP_002210282.1.52969 WP_002210282.1.53300 WP_002210282.1.53838 WP_002210282.1.53848 WP_002210282.1.53953 WP_002210282.1.54568 WP_002210282.1.54951 WP_002210282.1.55194 WP_002210282.1.55695 WP_002210282.1.5592 WP_002210282.1.56912 WP_002210282.1.56953 WP_002210282.1.57585 WP_002210282.1.57657 WP_002210282.1.58067 WP_002210282.1.58794 WP_002210282.1.59102 WP_002210282.1.59431 WP_002210282.1.5957 WP_002210282.1.59635 WP_002210282.1.59687 WP_002210282.1.59885 WP_002210282.1.60437 WP_002210282.1.60707 WP_002210282.1.60896 WP_002210282.1.61689 WP_002210282.1.62232 WP_002210282.1.62342 WP_002210282.1.6270 WP_002210282.1.63387 WP_002210282.1.64142 WP_002210282.1.64474 WP_002210282.1.64780 WP_002210282.1.64786 WP_002210282.1.64910 WP_002210282.1.653 WP_002210282.1.65400 WP_002210282.1.65554 WP_002210282.1.6570 WP_002210282.1.65706 WP_002210282.1.65718 WP_002210282.1.6581 WP_002210282.1.66118 WP_002210282.1.66546 WP_002210282.1.66616 WP_002210282.1.67404 WP_002210282.1.67850 WP_002210282.1.68361 WP_002210282.1.68753 WP_002210282.1.68855 WP_002210282.1.69018 WP_002210282.1.69316 WP_002210282.1.69951 WP_002210282.1.70117 WP_002210282.1.70171 WP_002210282.1.70319 WP_002210282.1.70377 WP_002210282.1.70417 WP_002210282.1.70726 WP_002210282.1.7083 WP_002210282.1.7169 WP_002210282.1.71744 WP_002210282.1.72280 WP_002210282.1.72440 WP_002210282.1.72486 WP_002210282.1.7402 WP_002210282.1.74131 WP_002210282.1.74310 WP_002210282.1.74577 WP_002210282.1.74738 WP_002210282.1.75173 WP_002210282.1.7518 WP_002210282.1.75337 WP_002210282.1.75407 WP_002210282.1.75636 WP_002210282.1.75689 WP_002210282.1.75821 WP_002210282.1.76670 WP_002210282.1.77387 WP_002210282.1.77429 WP_002210282.1.78004 WP_002210282.1.7841 WP_002210282.1.78556 WP_002210282.1.79515 WP_002210282.1.79550 WP_002210282.1.79609 WP_002210282.1.79981 WP_002210282.1.8009 WP_002210282.1.80331 WP_002210282.1.81848 WP_002210282.1.81877 WP_002210282.1.8210 WP_002210282.1.82133 WP_002210282.1.82151 WP_002210282.1.82270 WP_002210282.1.82619 WP_002210282.1.8303 WP_002210282.1.83039 WP_002210282.1.83265 WP_002210282.1.8420 WP_002210282.1.84703 WP_002210282.1.84720 WP_002210282.1.85269 WP_002210282.1.85270 WP_002210282.1.8559 WP_002210282.1.86034 WP_002210282.1.86413 WP_002210282.1.87107 WP_002210282.1.8728 WP_002210282.1.87418 WP_002210282.1.8762 WP_002210282.1.87853 WP_002210282.1.87988 WP_002210282.1.88362 WP_002210282.1.88472 WP_002210282.1.89359 WP_002210282.1.8964 WP_002210282.1.90176 WP_002210282.1.9051 WP_002210282.1.90624 WP_002210282.1.91373 WP_002210282.1.91844 WP_002210282.1.92030 WP_002210282.1.92331 WP_002210282.1.92604 WP_002210282.1.927 WP_002210282.1.9311 WP_002210282.1.9320 WP_002210282.1.93623 WP_002210282.1.93928 WP_002210282.1.94052 WP_002210282.1.94201 WP_002210282.1.94545 WP_002210282.1.94683 WP_002210282.1.95746 WP_002210282.1.95981 WP_002210282.1.97245 WP_002210282.1.97375 WP_002210282.1.97448 WP_002210282.1.97791 WP_002210282.1.97864 WP_002210282.1.97872 WP_002210282.1.97894 WP_002210282.1.99109 WP_002210282.1.99383 WP_002210282.1.9941 WP_002210282.1.99416 WP_002210282.1.99788 WP_002210282.1.99990 YP_002347519.1.25044 gi|108812314|ref|YP_648081.1| gi|218929644|ref|YP_002347519.1| gi|294504371|ref|YP_003568433.1| gi|384126605|ref|YP_005509219.1| gi|161511360|ref|NP_993697.2| gi|162421226|ref|YP_001606307.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]