SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384123223|ref|YP_005505843.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384123223|ref|YP_005505843.1|
Domain Number 1 Region: 1-390
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.13e-100
Family Cystathionine synthase-like 0.00000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384123223|ref|YP_005505843.1|
Sequence length 393
Comment putative aminotransferase [Yersinia pestis D106004]
Sequence
MDYNFDEVIDRSNTACEKWDAHYLNARFGMTDLTPMWVADMDFRSPDSVISALSERVNHG
IYGYTFRPDSFLDAITQWVKKRHQWLIKPEWISHSPGVVPGLAMAIRGLTKPGDKILIQS
PVYHHFANVIARNDREVVASELLYDNEKYDIDFAHFEACIATGVKLFILCNPHNPVGRVW
TRDELTTMGNICLRHNVIVIADEIHCDIVFKGSKFTPFASISPDFENNSITCMAPSKTFN
LLGTQTSAIIIPNQELRNKYETELNSLALGNPNPFGVIALETAYKEGEEWLESLLGYLQH
NLDFAVDFFKKYIPKITLVKPEGTYLLWLDCRGLGLTPYELEQFILTKAKLALNEGHIFG
ESGENFMRMNIGCPKSVLTSALIQLKYAVDDLN
Download sequence
Identical sequences A0A0E1NPA0 A0A0M1VDM9 Q0WCR0
gi|162420434|ref|YP_001607151.1| gi|145599389|ref|YP_001163465.1| gi|384127079|ref|YP_005509693.1| gi|218930053|ref|YP_002347928.1| WP_002208500.1.100083 WP_002208500.1.100593 WP_002208500.1.100921 WP_002208500.1.10105 WP_002208500.1.101305 WP_002208500.1.101928 WP_002208500.1.102012 WP_002208500.1.10736 WP_002208500.1.10935 WP_002208500.1.10955 WP_002208500.1.11693 WP_002208500.1.12463 WP_002208500.1.12857 WP_002208500.1.1388 WP_002208500.1.14063 WP_002208500.1.15321 WP_002208500.1.15555 WP_002208500.1.15605 WP_002208500.1.15689 WP_002208500.1.16243 WP_002208500.1.17135 WP_002208500.1.17141 WP_002208500.1.17608 WP_002208500.1.17873 WP_002208500.1.17983 WP_002208500.1.18208 WP_002208500.1.18640 WP_002208500.1.19329 WP_002208500.1.19425 WP_002208500.1.19739 WP_002208500.1.19763 WP_002208500.1.21784 WP_002208500.1.21879 WP_002208500.1.22542 WP_002208500.1.23271 WP_002208500.1.23687 WP_002208500.1.2451 WP_002208500.1.25181 WP_002208500.1.2640 WP_002208500.1.26960 WP_002208500.1.27124 WP_002208500.1.27251 WP_002208500.1.2726 WP_002208500.1.28647 WP_002208500.1.29186 WP_002208500.1.29355 WP_002208500.1.29622 WP_002208500.1.2964 WP_002208500.1.29685 WP_002208500.1.29814 WP_002208500.1.3092 WP_002208500.1.30931 WP_002208500.1.311 WP_002208500.1.31336 WP_002208500.1.31496 WP_002208500.1.31721 WP_002208500.1.32343 WP_002208500.1.32446 WP_002208500.1.33203 WP_002208500.1.33775 WP_002208500.1.33937 WP_002208500.1.34138 WP_002208500.1.35389 WP_002208500.1.35538 WP_002208500.1.36088 WP_002208500.1.37494 WP_002208500.1.37863 WP_002208500.1.38235 WP_002208500.1.38532 WP_002208500.1.38824 WP_002208500.1.38993 WP_002208500.1.39066 WP_002208500.1.3976 WP_002208500.1.40134 WP_002208500.1.40534 WP_002208500.1.41196 WP_002208500.1.4210 WP_002208500.1.42490 WP_002208500.1.44408 WP_002208500.1.44832 WP_002208500.1.45198 WP_002208500.1.45214 WP_002208500.1.46262 WP_002208500.1.46545 WP_002208500.1.46686 WP_002208500.1.46731 WP_002208500.1.47387 WP_002208500.1.47440 WP_002208500.1.48722 WP_002208500.1.4997 WP_002208500.1.50010 WP_002208500.1.50093 WP_002208500.1.50984 WP_002208500.1.51284 WP_002208500.1.51293 WP_002208500.1.51588 WP_002208500.1.51772 WP_002208500.1.51934 WP_002208500.1.52158 WP_002208500.1.52247 WP_002208500.1.52473 WP_002208500.1.52734 WP_002208500.1.52819 WP_002208500.1.53838 WP_002208500.1.53953 WP_002208500.1.54951 WP_002208500.1.55194 WP_002208500.1.5592 WP_002208500.1.56031 WP_002208500.1.57585 WP_002208500.1.58067 WP_002208500.1.59102 WP_002208500.1.59431 WP_002208500.1.5957 WP_002208500.1.59635 WP_002208500.1.5968 WP_002208500.1.59885 WP_002208500.1.60437 WP_002208500.1.60707 WP_002208500.1.60896 WP_002208500.1.62342 WP_002208500.1.6270 WP_002208500.1.64142 WP_002208500.1.64780 WP_002208500.1.64786 WP_002208500.1.64910 WP_002208500.1.653 WP_002208500.1.65554 WP_002208500.1.6570 WP_002208500.1.65718 WP_002208500.1.66118 WP_002208500.1.66616 WP_002208500.1.68361 WP_002208500.1.68371 WP_002208500.1.68753 WP_002208500.1.69018 WP_002208500.1.69316 WP_002208500.1.70117 WP_002208500.1.70171 WP_002208500.1.70319 WP_002208500.1.70377 WP_002208500.1.70417 WP_002208500.1.7083 WP_002208500.1.7169 WP_002208500.1.71744 WP_002208500.1.72280 WP_002208500.1.72440 WP_002208500.1.72486 WP_002208500.1.7402 WP_002208500.1.74310 WP_002208500.1.74738 WP_002208500.1.75169 WP_002208500.1.7518 WP_002208500.1.75337 WP_002208500.1.75636 WP_002208500.1.76555 WP_002208500.1.77295 WP_002208500.1.77387 WP_002208500.1.77429 WP_002208500.1.77569 WP_002208500.1.77691 WP_002208500.1.78004 WP_002208500.1.7841 WP_002208500.1.78556 WP_002208500.1.79550 WP_002208500.1.79825 WP_002208500.1.79981 WP_002208500.1.8009 WP_002208500.1.80331 WP_002208500.1.81848 WP_002208500.1.81877 WP_002208500.1.82133 WP_002208500.1.82151 WP_002208500.1.82270 WP_002208500.1.82436 WP_002208500.1.82619 WP_002208500.1.8303 WP_002208500.1.83039 WP_002208500.1.83265 WP_002208500.1.8420 WP_002208500.1.84720 WP_002208500.1.8559 WP_002208500.1.86034 WP_002208500.1.87107 WP_002208500.1.8728 WP_002208500.1.87418 WP_002208500.1.8762 WP_002208500.1.87988 WP_002208500.1.89359 WP_002208500.1.8964 WP_002208500.1.90624 WP_002208500.1.91373 WP_002208500.1.92030 WP_002208500.1.9311 WP_002208500.1.9320 WP_002208500.1.93623 WP_002208500.1.94201 WP_002208500.1.94545 WP_002208500.1.94683 WP_002208500.1.95746 WP_002208500.1.95981 WP_002208500.1.97245 WP_002208500.1.97375 WP_002208500.1.97448 WP_002208500.1.97791 WP_002208500.1.97894 WP_002208500.1.99109 WP_002208500.1.99972 WP_002208500.1.99990 YP_002347928.1.25044 gi|108808189|ref|YP_652105.1| gi|384123223|ref|YP_005505843.1| gi|384139147|ref|YP_005521849.1| gi|294504757|ref|YP_003568819.1| 214092.YPO3006 349746.YpAngola_A2760 360102.YPA_2195 386656.YPDSF_2113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]