SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384123320|ref|YP_005505940.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384123320|ref|YP_005505940.1|
Domain Number 1 Region: 37-250,278-430
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.84e-140
Family SCOPe 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384123320|ref|YP_005505940.1|
Sequence length 437
Comment putative CDP-4-keto-6-deoxy-D-glucose-3-dehydratase [Yersinia pestis D106004]
Sequence
MSQEELRQQIAELVAQYAETAMAPKPFEAGKSVVPPSGKVIGTKELQLMVEASLDGWLTT
GRFNDAFEKKLGEYLGVPYVLTTTSGSSANLLALTALTSPKLGVRALKPGDEVITVAAGF
PTTVNPTIQNGLIPVFVDVDIPTYNVNASLIEAAVSDKTKAIMIAHTLGNLFDLAEVRRV
ADKYNLWLIEDCCDALGSTYDGKMAGTFGDIGTVSFYPAHHITMGEGGAVFTQSAELKSI
IESFRDWGRDCYCAPGCDNTCKKRFGQQLGSLPFGYDHKYTYSHLGYNLKITDMQAACGL
AQLERIEEFVEKRKANFKYLKDALQSCADFIELPEATENSDPSWFGFPITLKEDSGVSRI
DLVKFLDEAKVGTRLLFAGNLTRQPYFHDVKYRVVGELTNTDRIMNQTFWIGIYPGLTHD
HLDYVVSKFEEFFGLNF
Download sequence
Identical sequences A0A0E1NRU2 A0A0E8XHG9 A0A0H2W2D6 A0A0H2YG23 A0A0M1VDT0 A0A208SB36 K4NPD0 Q57323 Q9RCD0
gi|384123320|ref|YP_005505940.1| gi|108808596|ref|YP_652512.1| WP_002208596.1.100921 WP_002208596.1.10105 WP_002208596.1.101305 WP_002208596.1.101382 WP_002208596.1.101928 WP_002208596.1.102012 WP_002208596.1.102067 WP_002208596.1.10535 WP_002208596.1.10736 WP_002208596.1.10935 WP_002208596.1.10955 WP_002208596.1.11693 WP_002208596.1.11800 WP_002208596.1.12167 WP_002208596.1.12463 WP_002208596.1.12736 WP_002208596.1.12857 WP_002208596.1.1388 WP_002208596.1.14063 WP_002208596.1.14804 WP_002208596.1.15321 WP_002208596.1.15555 WP_002208596.1.15605 WP_002208596.1.15689 WP_002208596.1.16243 WP_002208596.1.16333 WP_002208596.1.17135 WP_002208596.1.17141 WP_002208596.1.17608 WP_002208596.1.17873 WP_002208596.1.17983 WP_002208596.1.18208 WP_002208596.1.18640 WP_002208596.1.19329 WP_002208596.1.19425 WP_002208596.1.19739 WP_002208596.1.19763 WP_002208596.1.20547 WP_002208596.1.2064 WP_002208596.1.21784 WP_002208596.1.21879 WP_002208596.1.21934 WP_002208596.1.22542 WP_002208596.1.23157 WP_002208596.1.23271 WP_002208596.1.23687 WP_002208596.1.23811 WP_002208596.1.24002 WP_002208596.1.2451 WP_002208596.1.25181 WP_002208596.1.2640 WP_002208596.1.26776 WP_002208596.1.26960 WP_002208596.1.27124 WP_002208596.1.27251 WP_002208596.1.2726 WP_002208596.1.28647 WP_002208596.1.28922 WP_002208596.1.29157 WP_002208596.1.29186 WP_002208596.1.29355 WP_002208596.1.2947 WP_002208596.1.29622 WP_002208596.1.2964 WP_002208596.1.29685 WP_002208596.1.29814 WP_002208596.1.3092 WP_002208596.1.30931 WP_002208596.1.311 WP_002208596.1.31336 WP_002208596.1.31496 WP_002208596.1.31721 WP_002208596.1.31805 WP_002208596.1.32343 WP_002208596.1.32388 WP_002208596.1.32446 WP_002208596.1.33203 WP_002208596.1.33775 WP_002208596.1.33937 WP_002208596.1.34031 WP_002208596.1.34138 WP_002208596.1.35389 WP_002208596.1.35538 WP_002208596.1.36088 WP_002208596.1.37174 WP_002208596.1.37494 WP_002208596.1.37863 WP_002208596.1.38235 WP_002208596.1.38743 WP_002208596.1.38824 WP_002208596.1.38993 WP_002208596.1.39066 WP_002208596.1.3976 WP_002208596.1.40071 WP_002208596.1.40110 WP_002208596.1.40134 WP_002208596.1.40534 WP_002208596.1.41196 WP_002208596.1.41984 WP_002208596.1.42490 WP_002208596.1.42976 WP_002208596.1.44408 WP_002208596.1.44598 WP_002208596.1.44832 WP_002208596.1.45198 WP_002208596.1.45214 WP_002208596.1.46262 WP_002208596.1.46545 WP_002208596.1.46686 WP_002208596.1.46731 WP_002208596.1.46891 WP_002208596.1.47387 WP_002208596.1.47440 WP_002208596.1.47769 WP_002208596.1.48722 WP_002208596.1.49315 WP_002208596.1.49906 WP_002208596.1.4997 WP_002208596.1.50010 WP_002208596.1.50093 WP_002208596.1.50984 WP_002208596.1.51284 WP_002208596.1.51293 WP_002208596.1.51588 WP_002208596.1.51772 WP_002208596.1.51934 WP_002208596.1.52158 WP_002208596.1.52247 WP_002208596.1.52473 WP_002208596.1.52734 WP_002208596.1.52819 WP_002208596.1.53838 WP_002208596.1.53848 WP_002208596.1.53953 WP_002208596.1.54568 WP_002208596.1.54951 WP_002208596.1.5592 WP_002208596.1.56031 WP_002208596.1.57585 WP_002208596.1.57657 WP_002208596.1.58067 WP_002208596.1.58794 WP_002208596.1.59102 WP_002208596.1.59431 WP_002208596.1.5957 WP_002208596.1.59635 WP_002208596.1.5968 WP_002208596.1.59885 WP_002208596.1.60437 WP_002208596.1.60707 WP_002208596.1.60896 WP_002208596.1.62232 WP_002208596.1.62342 WP_002208596.1.63387 WP_002208596.1.63517 WP_002208596.1.64142 WP_002208596.1.64474 WP_002208596.1.64780 WP_002208596.1.64786 WP_002208596.1.64910 WP_002208596.1.653 WP_002208596.1.65400 WP_002208596.1.65554 WP_002208596.1.6570 WP_002208596.1.65706 WP_002208596.1.65718 WP_002208596.1.6581 WP_002208596.1.66118 WP_002208596.1.66546 WP_002208596.1.66616 WP_002208596.1.67404 WP_002208596.1.67850 WP_002208596.1.68361 WP_002208596.1.68855 WP_002208596.1.69018 WP_002208596.1.69316 WP_002208596.1.69951 WP_002208596.1.70117 WP_002208596.1.70171 WP_002208596.1.70319 WP_002208596.1.70377 WP_002208596.1.70417 WP_002208596.1.70726 WP_002208596.1.7083 WP_002208596.1.7169 WP_002208596.1.71744 WP_002208596.1.72440 WP_002208596.1.72486 WP_002208596.1.7402 WP_002208596.1.74131 WP_002208596.1.74310 WP_002208596.1.74577 WP_002208596.1.74738 WP_002208596.1.75169 WP_002208596.1.7518 WP_002208596.1.75337 WP_002208596.1.75407 WP_002208596.1.75636 WP_002208596.1.77295 WP_002208596.1.77387 WP_002208596.1.77429 WP_002208596.1.77569 WP_002208596.1.77691 WP_002208596.1.78004 WP_002208596.1.7841 WP_002208596.1.78556 WP_002208596.1.7939 WP_002208596.1.79550 WP_002208596.1.79825 WP_002208596.1.79981 WP_002208596.1.8009 WP_002208596.1.80331 WP_002208596.1.81848 WP_002208596.1.81877 WP_002208596.1.8210 WP_002208596.1.82133 WP_002208596.1.82151 WP_002208596.1.82270 WP_002208596.1.82619 WP_002208596.1.8303 WP_002208596.1.83039 WP_002208596.1.83265 WP_002208596.1.8420 WP_002208596.1.84703 WP_002208596.1.84720 WP_002208596.1.85269 WP_002208596.1.85270 WP_002208596.1.8559 WP_002208596.1.85802 WP_002208596.1.86034 WP_002208596.1.86413 WP_002208596.1.87107 WP_002208596.1.8728 WP_002208596.1.87418 WP_002208596.1.8762 WP_002208596.1.87853 WP_002208596.1.87988 WP_002208596.1.88362 WP_002208596.1.89359 WP_002208596.1.8964 WP_002208596.1.90176 WP_002208596.1.9051 WP_002208596.1.90624 WP_002208596.1.91373 WP_002208596.1.92030 WP_002208596.1.92604 WP_002208596.1.927 WP_002208596.1.9311 WP_002208596.1.9320 WP_002208596.1.93623 WP_002208596.1.93928 WP_002208596.1.94052 WP_002208596.1.94201 WP_002208596.1.94545 WP_002208596.1.94683 WP_002208596.1.95746 WP_002208596.1.95981 WP_002208596.1.97245 WP_002208596.1.97375 WP_002208596.1.97448 WP_002208596.1.97791 WP_002208596.1.97864 WP_002208596.1.97894 WP_002208596.1.99109 WP_002208596.1.9941 WP_002208596.1.99972 WP_002208596.1.99990 YP_002348022.1.25044 gi|384139045|ref|YP_005521747.1| 3bcx_A 3bcx_B gi|384415793|ref|YP_005625155.1| gi|294504852|ref|YP_003568914.1| gi|218930147|ref|YP_002348022.1| gi|384127173|ref|YP_005509787.1| gi|45440666|ref|NP_992205.1| 214092.YPO3113 229193.YP_0817 360102.YPA_2605 377628.YPN_0977 386656.YPDSF_2749 gi|145600008|ref|YP_001164084.1| gi|108811142|ref|YP_646909.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]