SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384123434|ref|YP_005506054.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384123434|ref|YP_005506054.1|
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.02e-16
Family Cystathionine synthase-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384123434|ref|YP_005506054.1|
Sequence length 152
Comment class V aminotransferase [Yersinia pestis D106004]
Sequence
MHRSLQHGSALLAGIQGMGLSVFGDRKHRMNNVLGVVIPKGIPGEQVRQLLLNDFGIEIG
TSFGPLNGKIWRIGTMGYNARKDCVMQTLVALEAVLNRLGFTTVQGAGLQATWDVYQVDS
AHQVDSAHQVDSTHQADSAQRNSDHAQLNGAN
Download sequence
Identical sequences A0A0H2Y8U6 A0A0M1VDR6 A0A151PLV6
360102.YPA_2741 386656.YPDSF_2886 gi|384123434|ref|YP_005506054.1| WP_002208730.1.100083 WP_002208730.1.100921 WP_002208730.1.100931 WP_002208730.1.10105 WP_002208730.1.101305 WP_002208730.1.101928 WP_002208730.1.102012 WP_002208730.1.10736 WP_002208730.1.10935 WP_002208730.1.10955 WP_002208730.1.11693 WP_002208730.1.12463 WP_002208730.1.12736 WP_002208730.1.12857 WP_002208730.1.1388 WP_002208730.1.14063 WP_002208730.1.15555 WP_002208730.1.15605 WP_002208730.1.15689 WP_002208730.1.16243 WP_002208730.1.17135 WP_002208730.1.17141 WP_002208730.1.17608 WP_002208730.1.17873 WP_002208730.1.17983 WP_002208730.1.18208 WP_002208730.1.18640 WP_002208730.1.19425 WP_002208730.1.19739 WP_002208730.1.19763 WP_002208730.1.21486 WP_002208730.1.21784 WP_002208730.1.21879 WP_002208730.1.22542 WP_002208730.1.22708 WP_002208730.1.23271 WP_002208730.1.23687 WP_002208730.1.2451 WP_002208730.1.25394 WP_002208730.1.2640 WP_002208730.1.26960 WP_002208730.1.27124 WP_002208730.1.2726 WP_002208730.1.29355 WP_002208730.1.29622 WP_002208730.1.2964 WP_002208730.1.29685 WP_002208730.1.29814 WP_002208730.1.3092 WP_002208730.1.30931 WP_002208730.1.31496 WP_002208730.1.32343 WP_002208730.1.32388 WP_002208730.1.32446 WP_002208730.1.33203 WP_002208730.1.33661 WP_002208730.1.33937 WP_002208730.1.34138 WP_002208730.1.35538 WP_002208730.1.36088 WP_002208730.1.37174 WP_002208730.1.37494 WP_002208730.1.37863 WP_002208730.1.38147 WP_002208730.1.38235 WP_002208730.1.38824 WP_002208730.1.39066 WP_002208730.1.39346 WP_002208730.1.40134 WP_002208730.1.40534 WP_002208730.1.41196 WP_002208730.1.44408 WP_002208730.1.44598 WP_002208730.1.44603 WP_002208730.1.44832 WP_002208730.1.45198 WP_002208730.1.46545 WP_002208730.1.46686 WP_002208730.1.47387 WP_002208730.1.48722 WP_002208730.1.49906 WP_002208730.1.4997 WP_002208730.1.50010 WP_002208730.1.50093 WP_002208730.1.50106 WP_002208730.1.50984 WP_002208730.1.51284 WP_002208730.1.51293 WP_002208730.1.51588 WP_002208730.1.51772 WP_002208730.1.51934 WP_002208730.1.52158 WP_002208730.1.52247 WP_002208730.1.52819 WP_002208730.1.52969 WP_002208730.1.53838 WP_002208730.1.53953 WP_002208730.1.54951 WP_002208730.1.55194 WP_002208730.1.55695 WP_002208730.1.5592 WP_002208730.1.57585 WP_002208730.1.58067 WP_002208730.1.58794 WP_002208730.1.59102 WP_002208730.1.59431 WP_002208730.1.5957 WP_002208730.1.59635 WP_002208730.1.59687 WP_002208730.1.60437 WP_002208730.1.60707 WP_002208730.1.61689 WP_002208730.1.62342 WP_002208730.1.6270 WP_002208730.1.64142 WP_002208730.1.64786 WP_002208730.1.64910 WP_002208730.1.653 WP_002208730.1.65400 WP_002208730.1.65554 WP_002208730.1.6570 WP_002208730.1.65718 WP_002208730.1.66118 WP_002208730.1.66616 WP_002208730.1.67850 WP_002208730.1.68361 WP_002208730.1.69018 WP_002208730.1.69316 WP_002208730.1.70171 WP_002208730.1.70319 WP_002208730.1.70377 WP_002208730.1.70417 WP_002208730.1.7083 WP_002208730.1.7169 WP_002208730.1.71744 WP_002208730.1.72440 WP_002208730.1.74131 WP_002208730.1.74310 WP_002208730.1.74738 WP_002208730.1.75173 WP_002208730.1.7518 WP_002208730.1.75636 WP_002208730.1.76670 WP_002208730.1.77387 WP_002208730.1.77429 WP_002208730.1.77691 WP_002208730.1.78004 WP_002208730.1.7841 WP_002208730.1.78556 WP_002208730.1.79609 WP_002208730.1.79981 WP_002208730.1.8009 WP_002208730.1.80331 WP_002208730.1.81848 WP_002208730.1.81877 WP_002208730.1.82133 WP_002208730.1.82151 WP_002208730.1.82270 WP_002208730.1.82619 WP_002208730.1.8303 WP_002208730.1.83265 WP_002208730.1.8420 WP_002208730.1.84720 WP_002208730.1.8559 WP_002208730.1.86034 WP_002208730.1.87107 WP_002208730.1.8728 WP_002208730.1.87418 WP_002208730.1.8762 WP_002208730.1.87988 WP_002208730.1.89359 WP_002208730.1.8964 WP_002208730.1.9051 WP_002208730.1.91373 WP_002208730.1.927 WP_002208730.1.9311 WP_002208730.1.9320 WP_002208730.1.93623 WP_002208730.1.93933 WP_002208730.1.94201 WP_002208730.1.94683 WP_002208730.1.95746 WP_002208730.1.95981 WP_002208730.1.97245 WP_002208730.1.97375 WP_002208730.1.97448 WP_002208730.1.97791 WP_002208730.1.97864 WP_002208730.1.97894 WP_002208730.1.99109 gi|108808732|ref|YP_652648.1| gi|145600145|ref|YP_001164221.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]