SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384123437|ref|YP_005506057.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384123437|ref|YP_005506057.1|
Domain Number 1 Region: 17-301
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.09e-67
Family Cystathionine synthase-like 0.00000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384123437|ref|YP_005506057.1|
Sequence length 307
Comment hypothetical protein YPD4_2847, partial [Yersinia pestis D106004]
Sequence
MSEINPNPLFRQINPPARLLMGPGPINADPRVLRAMSSQLIGQYDPAMTDYMNQVMALYR
GVFRTENRWTMLIDGTSRAGIEAILLSAIRPGDKVLIPVFGRFGYLLCEIARRCRAEVHI
IEVPWGEVFSPDRIEDAIKHIRPRLLLTVQGDTSTTMLQPLAELGDICRRHQVLFYTDAT
ASLGGNPLETDAWGLDAVSAGLQKCLGGPSGSSPITLSPQFAEQIRRRKCIEQGIRTSDH
ADGDEEMIYSNYFDLGMIMDYWGPERLNHHTEATSMLFAARECARVILEEGLDHGIARHA
LHGVNDG
Download sequence
Identical sequences A0A0E1NXP4 A0A0M1VDP2 A0A154RMV9
gi|384123437|ref|YP_005506057.1| gi|294504969|ref|YP_003569031.1| gi|384138907|ref|YP_005521609.1| WP_002208731.1.100083 WP_002208731.1.100246 WP_002208731.1.100921 WP_002208731.1.100931 WP_002208731.1.10105 WP_002208731.1.101305 WP_002208731.1.101382 WP_002208731.1.101928 WP_002208731.1.102012 WP_002208731.1.102067 WP_002208731.1.10736 WP_002208731.1.10935 WP_002208731.1.10955 WP_002208731.1.11693 WP_002208731.1.12463 WP_002208731.1.12736 WP_002208731.1.12857 WP_002208731.1.1388 WP_002208731.1.14063 WP_002208731.1.14804 WP_002208731.1.15321 WP_002208731.1.15555 WP_002208731.1.15605 WP_002208731.1.15689 WP_002208731.1.16243 WP_002208731.1.17141 WP_002208731.1.17608 WP_002208731.1.17873 WP_002208731.1.17983 WP_002208731.1.18208 WP_002208731.1.18640 WP_002208731.1.19425 WP_002208731.1.19739 WP_002208731.1.19763 WP_002208731.1.20035 WP_002208731.1.2064 WP_002208731.1.21486 WP_002208731.1.21784 WP_002208731.1.21879 WP_002208731.1.22542 WP_002208731.1.22708 WP_002208731.1.23271 WP_002208731.1.23687 WP_002208731.1.2451 WP_002208731.1.25394 WP_002208731.1.2640 WP_002208731.1.26776 WP_002208731.1.26960 WP_002208731.1.27124 WP_002208731.1.2726 WP_002208731.1.28647 WP_002208731.1.29355 WP_002208731.1.29622 WP_002208731.1.2964 WP_002208731.1.29685 WP_002208731.1.29814 WP_002208731.1.3092 WP_002208731.1.31496 WP_002208731.1.31739 WP_002208731.1.31805 WP_002208731.1.32343 WP_002208731.1.32388 WP_002208731.1.32446 WP_002208731.1.33203 WP_002208731.1.33661 WP_002208731.1.33937 WP_002208731.1.34031 WP_002208731.1.34138 WP_002208731.1.35538 WP_002208731.1.36088 WP_002208731.1.37174 WP_002208731.1.37494 WP_002208731.1.37863 WP_002208731.1.38147 WP_002208731.1.38235 WP_002208731.1.38743 WP_002208731.1.38824 WP_002208731.1.39066 WP_002208731.1.39346 WP_002208731.1.40071 WP_002208731.1.40134 WP_002208731.1.40534 WP_002208731.1.40853 WP_002208731.1.41196 WP_002208731.1.44408 WP_002208731.1.44603 WP_002208731.1.45198 WP_002208731.1.46262 WP_002208731.1.46545 WP_002208731.1.46686 WP_002208731.1.4678 WP_002208731.1.46891 WP_002208731.1.47387 WP_002208731.1.48722 WP_002208731.1.4889 WP_002208731.1.49906 WP_002208731.1.4997 WP_002208731.1.50010 WP_002208731.1.50093 WP_002208731.1.50106 WP_002208731.1.50984 WP_002208731.1.51284 WP_002208731.1.51293 WP_002208731.1.51588 WP_002208731.1.51772 WP_002208731.1.51934 WP_002208731.1.52158 WP_002208731.1.52247 WP_002208731.1.52819 WP_002208731.1.52969 WP_002208731.1.53838 WP_002208731.1.53848 WP_002208731.1.53953 WP_002208731.1.54951 WP_002208731.1.55194 WP_002208731.1.55695 WP_002208731.1.5592 WP_002208731.1.56912 WP_002208731.1.56953 WP_002208731.1.57585 WP_002208731.1.58067 WP_002208731.1.58794 WP_002208731.1.59102 WP_002208731.1.59431 WP_002208731.1.5957 WP_002208731.1.59635 WP_002208731.1.59687 WP_002208731.1.59789 WP_002208731.1.60437 WP_002208731.1.60707 WP_002208731.1.61689 WP_002208731.1.62342 WP_002208731.1.6270 WP_002208731.1.63387 WP_002208731.1.64142 WP_002208731.1.64780 WP_002208731.1.64786 WP_002208731.1.64910 WP_002208731.1.653 WP_002208731.1.65400 WP_002208731.1.65554 WP_002208731.1.6570 WP_002208731.1.65718 WP_002208731.1.66118 WP_002208731.1.66546 WP_002208731.1.66616 WP_002208731.1.67404 WP_002208731.1.67850 WP_002208731.1.68361 WP_002208731.1.68855 WP_002208731.1.69018 WP_002208731.1.69316 WP_002208731.1.70171 WP_002208731.1.70319 WP_002208731.1.70377 WP_002208731.1.70417 WP_002208731.1.7083 WP_002208731.1.71744 WP_002208731.1.72440 WP_002208731.1.74131 WP_002208731.1.74310 WP_002208731.1.74577 WP_002208731.1.74738 WP_002208731.1.75173 WP_002208731.1.7518 WP_002208731.1.75407 WP_002208731.1.75636 WP_002208731.1.75689 WP_002208731.1.75821 WP_002208731.1.76670 WP_002208731.1.77387 WP_002208731.1.77429 WP_002208731.1.77691 WP_002208731.1.78004 WP_002208731.1.7841 WP_002208731.1.78556 WP_002208731.1.79550 WP_002208731.1.79609 WP_002208731.1.79981 WP_002208731.1.8009 WP_002208731.1.80331 WP_002208731.1.81848 WP_002208731.1.81877 WP_002208731.1.8210 WP_002208731.1.82133 WP_002208731.1.82151 WP_002208731.1.82270 WP_002208731.1.82619 WP_002208731.1.8303 WP_002208731.1.83265 WP_002208731.1.8420 WP_002208731.1.84720 WP_002208731.1.85269 WP_002208731.1.85270 WP_002208731.1.8559 WP_002208731.1.86034 WP_002208731.1.87107 WP_002208731.1.8728 WP_002208731.1.87418 WP_002208731.1.8762 WP_002208731.1.87853 WP_002208731.1.87988 WP_002208731.1.89359 WP_002208731.1.8964 WP_002208731.1.9051 WP_002208731.1.91373 WP_002208731.1.91844 WP_002208731.1.92331 WP_002208731.1.927 WP_002208731.1.9311 WP_002208731.1.9320 WP_002208731.1.93623 WP_002208731.1.93933 WP_002208731.1.94201 WP_002208731.1.94545 WP_002208731.1.94683 WP_002208731.1.95746 WP_002208731.1.95981 WP_002208731.1.97245 WP_002208731.1.97375 WP_002208731.1.97448 WP_002208731.1.97791 WP_002208731.1.97864 WP_002208731.1.97894 WP_002208731.1.99109 WP_002208731.1.9941 WP_002208731.1.99788 WP_002208731.1.99990 gi|384127293|ref|YP_005509907.1| 360102.YPA_2744 386656.YPDSF_2889 gi|108808735|ref|YP_652651.1| gi|145600148|ref|YP_001164224.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]