SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384123560|ref|YP_005506180.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384123560|ref|YP_005506180.1|
Domain Number 1 Region: 2-425
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.73e-137
Family GABA-aminotransferase-like 0.00000000097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384123560|ref|YP_005506180.1|
Sequence length 426
Comment glutamate-1-semialdehyde aminotransferase [Yersinia pestis D106004]
Sequence
MSKSENLYAQAQQLIPGGVNSPVRAFTGVGGIPLFIERADGAYLFDVDGKAYIDYVGSWG
PMILGHNHPAIRQAVIEAVERGLSFGAPTEMEVKMAQLVTDLVPTMDMVRMVNSGTEATM
SAIRLARGYTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQPNSPGVPTDFAKHTLTCT
YNDLASVRQAFEQYPQEVACIIVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVM
TGFRVALAGAQDYYHVIPDLTCLGKIIGGGMPVGAFGGRREVMNALAPTGPVYQAGTLSG
NPIAMAAGFACLTEISQVGVYETLTELTDSLATGLRHAAKEENIPLVVNHVGGMFGLFFT
NADTVTCYQDVMNCDVERFKRFFHLMLEEGVYLAPSAFEAGFMSLAHSNEDIQKTVNAAR
RCFAKL
Download sequence
Identical sequences A0A0E1NQD0 A0A0M1VB91 A0A154TBZ7 A0A208SAP0 A4TPW6 A9R1E6 Q1C3X1 Q1CLU7 Q8ZBL9
gi|162421547|ref|YP_001605556.1| gi|22124712|ref|NP_668135.1| gi|384416085|ref|YP_005625447.1| gi|384138764|ref|YP_005521466.1| gi|294505095|ref|YP_003569157.1| WP_002209362.1.100083 WP_002209362.1.100246 WP_002209362.1.100921 WP_002209362.1.100931 WP_002209362.1.10105 WP_002209362.1.101305 WP_002209362.1.101382 WP_002209362.1.101928 WP_002209362.1.102012 WP_002209362.1.102067 WP_002209362.1.10736 WP_002209362.1.10935 WP_002209362.1.10955 WP_002209362.1.11693 WP_002209362.1.12463 WP_002209362.1.12736 WP_002209362.1.12857 WP_002209362.1.1388 WP_002209362.1.14063 WP_002209362.1.14804 WP_002209362.1.15321 WP_002209362.1.15555 WP_002209362.1.15605 WP_002209362.1.15689 WP_002209362.1.16243 WP_002209362.1.16333 WP_002209362.1.17135 WP_002209362.1.17141 WP_002209362.1.17608 WP_002209362.1.17873 WP_002209362.1.17983 WP_002209362.1.18208 WP_002209362.1.18826 WP_002209362.1.19329 WP_002209362.1.19425 WP_002209362.1.19739 WP_002209362.1.19763 WP_002209362.1.20035 WP_002209362.1.2064 WP_002209362.1.21486 WP_002209362.1.21784 WP_002209362.1.21879 WP_002209362.1.21934 WP_002209362.1.22530 WP_002209362.1.22542 WP_002209362.1.22708 WP_002209362.1.23157 WP_002209362.1.23271 WP_002209362.1.23687 WP_002209362.1.23811 WP_002209362.1.24002 WP_002209362.1.2451 WP_002209362.1.25181 WP_002209362.1.25394 WP_002209362.1.2640 WP_002209362.1.26776 WP_002209362.1.26960 WP_002209362.1.27124 WP_002209362.1.27251 WP_002209362.1.2726 WP_002209362.1.28647 WP_002209362.1.28922 WP_002209362.1.29157 WP_002209362.1.29355 WP_002209362.1.2947 WP_002209362.1.29622 WP_002209362.1.2964 WP_002209362.1.29685 WP_002209362.1.29814 WP_002209362.1.3092 WP_002209362.1.30931 WP_002209362.1.311 WP_002209362.1.31336 WP_002209362.1.31496 WP_002209362.1.31739 WP_002209362.1.31805 WP_002209362.1.32343 WP_002209362.1.32388 WP_002209362.1.32446 WP_002209362.1.33203 WP_002209362.1.33661 WP_002209362.1.33937 WP_002209362.1.34031 WP_002209362.1.34138 WP_002209362.1.35389 WP_002209362.1.35538 WP_002209362.1.36088 WP_002209362.1.37174 WP_002209362.1.37494 WP_002209362.1.37863 WP_002209362.1.38147 WP_002209362.1.38235 WP_002209362.1.38743 WP_002209362.1.38824 WP_002209362.1.38993 WP_002209362.1.39066 WP_002209362.1.39346 WP_002209362.1.3976 WP_002209362.1.40071 WP_002209362.1.40134 WP_002209362.1.40534 WP_002209362.1.40853 WP_002209362.1.41196 WP_002209362.1.4210 WP_002209362.1.42490 WP_002209362.1.44408 WP_002209362.1.44598 WP_002209362.1.44603 WP_002209362.1.44832 WP_002209362.1.45198 WP_002209362.1.45214 WP_002209362.1.46262 WP_002209362.1.46545 WP_002209362.1.46686 WP_002209362.1.46731 WP_002209362.1.4678 WP_002209362.1.46891 WP_002209362.1.47387 WP_002209362.1.47440 WP_002209362.1.48166 WP_002209362.1.48722 WP_002209362.1.4889 WP_002209362.1.49906 WP_002209362.1.50010 WP_002209362.1.50093 WP_002209362.1.50106 WP_002209362.1.50984 WP_002209362.1.51284 WP_002209362.1.51293 WP_002209362.1.51588 WP_002209362.1.51772 WP_002209362.1.51934 WP_002209362.1.52158 WP_002209362.1.52247 WP_002209362.1.52734 WP_002209362.1.52819 WP_002209362.1.52969 WP_002209362.1.53300 WP_002209362.1.53838 WP_002209362.1.53848 WP_002209362.1.53953 WP_002209362.1.54568 WP_002209362.1.54951 WP_002209362.1.55194 WP_002209362.1.55695 WP_002209362.1.5592 WP_002209362.1.56031 WP_002209362.1.56912 WP_002209362.1.56953 WP_002209362.1.57585 WP_002209362.1.57657 WP_002209362.1.58067 WP_002209362.1.58794 WP_002209362.1.59102 WP_002209362.1.59431 WP_002209362.1.5957 WP_002209362.1.59687 WP_002209362.1.59789 WP_002209362.1.59885 WP_002209362.1.60437 WP_002209362.1.60707 WP_002209362.1.60896 WP_002209362.1.61689 WP_002209362.1.62232 WP_002209362.1.62342 WP_002209362.1.6270 WP_002209362.1.63387 WP_002209362.1.64142 WP_002209362.1.64474 WP_002209362.1.64780 WP_002209362.1.64910 WP_002209362.1.653 WP_002209362.1.65400 WP_002209362.1.65554 WP_002209362.1.6570 WP_002209362.1.65706 WP_002209362.1.65718 WP_002209362.1.6581 WP_002209362.1.66118 WP_002209362.1.66546 WP_002209362.1.66616 WP_002209362.1.67850 WP_002209362.1.68753 WP_002209362.1.68855 WP_002209362.1.69316 WP_002209362.1.69951 WP_002209362.1.70117 WP_002209362.1.70171 WP_002209362.1.70319 WP_002209362.1.70377 WP_002209362.1.70417 WP_002209362.1.70726 WP_002209362.1.7083 WP_002209362.1.7169 WP_002209362.1.71744 WP_002209362.1.72280 WP_002209362.1.72440 WP_002209362.1.72486 WP_002209362.1.7402 WP_002209362.1.74131 WP_002209362.1.74310 WP_002209362.1.74577 WP_002209362.1.74738 WP_002209362.1.75173 WP_002209362.1.7518 WP_002209362.1.75337 WP_002209362.1.75407 WP_002209362.1.75636 WP_002209362.1.75689 WP_002209362.1.75821 WP_002209362.1.77387 WP_002209362.1.77429 WP_002209362.1.77691 WP_002209362.1.78004 WP_002209362.1.7841 WP_002209362.1.78556 WP_002209362.1.79515 WP_002209362.1.79550 WP_002209362.1.79609 WP_002209362.1.8009 WP_002209362.1.81877 WP_002209362.1.8210 WP_002209362.1.82133 WP_002209362.1.82270 WP_002209362.1.82619 WP_002209362.1.8303 WP_002209362.1.83039 WP_002209362.1.83265 WP_002209362.1.84703 WP_002209362.1.84720 WP_002209362.1.85269 WP_002209362.1.8559 WP_002209362.1.85802 WP_002209362.1.86034 WP_002209362.1.86413 WP_002209362.1.87107 WP_002209362.1.87418 WP_002209362.1.8762 WP_002209362.1.87853 WP_002209362.1.87988 WP_002209362.1.88362 WP_002209362.1.88472 WP_002209362.1.89359 WP_002209362.1.8964 WP_002209362.1.9051 WP_002209362.1.90624 WP_002209362.1.91373 WP_002209362.1.91844 WP_002209362.1.92030 WP_002209362.1.92331 WP_002209362.1.927 WP_002209362.1.9311 WP_002209362.1.93623 WP_002209362.1.93928 WP_002209362.1.93933 WP_002209362.1.94052 WP_002209362.1.94201 WP_002209362.1.94545 WP_002209362.1.94683 WP_002209362.1.95746 WP_002209362.1.95981 WP_002209362.1.97245 WP_002209362.1.97375 WP_002209362.1.97448 WP_002209362.1.97791 WP_002209362.1.97864 WP_002209362.1.97872 WP_002209362.1.97894 WP_002209362.1.99109 WP_002209362.1.99383 WP_002209362.1.9941 WP_002209362.1.99416 WP_002209362.1.99788 WP_002209362.1.99990 YP_002348281.1.25044 d4e77a_ gi|108808880|ref|YP_652796.1| gi|45440155|ref|NP_991694.1| 187410.y0799 214092.YPO3389 229193.YP_0296 349746.YpAngola_A0995 360102.YPA_2889 377628.YPN_0701 386656.YPDSF_2968 gi|145600225|ref|YP_001164301.1| gi|218930406|ref|YP_002348281.1| gi|384127421|ref|YP_005510035.1| gi|384123560|ref|YP_005506180.1| gi|108810866|ref|YP_646633.1| IDP90789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]