SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384123815|ref|YP_005506435.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384123815|ref|YP_005506435.1|
Domain Number 1 Region: 344-429
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.13e-22
Family CorC/HlyC domain-like 0.0000424
Further Details:      
 
Domain Number 2 Region: 200-335
Classification Level Classification E-value
Superfamily CBS-domain pair 5.97e-21
Family CBS-domain pair 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384123815|ref|YP_005506435.1|
Sequence length 443
Comment hypothetical protein YPD4_3228 [Yersinia pestis D106004]
Sequence
MLNSILLILFLIAVSAFFSLSEISLAASRKIKLKLLADEGDTNALRVLKLQETPGMFFTV
VQIGLNAVAILGGIVGDAAFSPSFKLVFERFMAPELADQASFVCSFVLVTSLFILFADLT
PKRIGMISPEAVAVRIVNPMRFCLMIFRPLVWFFNGMANLIFRLFKLPMVRNDDITSDDI
YAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTSRENVIYFDLRESEDSIKDKIST
HPHSKFLVCDGHIDQVVGYVDSKDLLNRVLGNQSLVLSSGVQIRSALIVPDTLTLSEALE
SFKTAGEDFAVILNEYALVVGIITLNDVMTTLMGDLVGQGQEEQIVARDENSWLIEGGTP
IEDVMRVLHIDDFPQSGNYETIGGFMMYMLRKIPKRTDFVKYAGYKFEVVDIDSYKIDQL
LVTRLSDQPAPILPKAPHESSDA
Download sequence
Identical sequences A0A0E1NPY6 A0A0E8XJF7 A0A0H2W369 A0A0H2YKL2 A0A0H3B8H1 A0A0M1V917 A0A0T9JF78 A0A0T9P752 A0A0U1ES95 A0A0U1QX91 A0A208S1Z1 Q66F90 Q7CKK6
gi|51594802|ref|YP_068993.1| gi|384138622|ref|YP_005521324.1| gi|186893811|ref|YP_001870923.1| gi|108806074|ref|YP_649990.1| gi|108813430|ref|YP_649197.1| gi|218930540|ref|YP_002348415.1| gi|45440411|ref|NP_991950.1| 187410.y0657 214092.YPO3526 229193.YP_0557 273123.YPTB0450 349747.YpsIP31758_3627 360102.YPA_0076 377628.YPN_3270 386656.YPDSF_3575 502800.YPK_3772 502801.YPTS_0480 gi|22124571|ref|NP_667994.1| gi|153948297|ref|YP_001402581.1| gi|384123815|ref|YP_005506435.1| WP_002210164.1.100083 WP_002210164.1.100246 WP_002210164.1.100593 WP_002210164.1.10066 WP_002210164.1.100921 WP_002210164.1.100931 WP_002210164.1.10105 WP_002210164.1.101305 WP_002210164.1.101382 WP_002210164.1.101928 WP_002210164.1.102012 WP_002210164.1.102067 WP_002210164.1.10535 WP_002210164.1.10736 WP_002210164.1.10935 WP_002210164.1.10955 WP_002210164.1.11693 WP_002210164.1.11800 WP_002210164.1.12167 WP_002210164.1.12463 WP_002210164.1.12736 WP_002210164.1.12857 WP_002210164.1.1388 WP_002210164.1.14063 WP_002210164.1.14169 WP_002210164.1.14804 WP_002210164.1.15321 WP_002210164.1.15555 WP_002210164.1.15605 WP_002210164.1.15689 WP_002210164.1.16243 WP_002210164.1.17135 WP_002210164.1.17141 WP_002210164.1.17608 WP_002210164.1.17873 WP_002210164.1.17983 WP_002210164.1.18208 WP_002210164.1.18640 WP_002210164.1.18826 WP_002210164.1.19425 WP_002210164.1.19739 WP_002210164.1.19763 WP_002210164.1.20035 WP_002210164.1.2064 WP_002210164.1.20932 WP_002210164.1.21486 WP_002210164.1.21784 WP_002210164.1.21879 WP_002210164.1.21934 WP_002210164.1.22530 WP_002210164.1.22542 WP_002210164.1.22708 WP_002210164.1.23157 WP_002210164.1.23271 WP_002210164.1.23687 WP_002210164.1.23811 WP_002210164.1.24002 WP_002210164.1.2451 WP_002210164.1.24517 WP_002210164.1.25181 WP_002210164.1.25394 WP_002210164.1.26383 WP_002210164.1.2640 WP_002210164.1.26776 WP_002210164.1.26960 WP_002210164.1.27124 WP_002210164.1.27251 WP_002210164.1.2726 WP_002210164.1.28647 WP_002210164.1.28922 WP_002210164.1.29157 WP_002210164.1.29186 WP_002210164.1.29355 WP_002210164.1.2947 WP_002210164.1.29622 WP_002210164.1.2964 WP_002210164.1.29685 WP_002210164.1.29814 WP_002210164.1.3092 WP_002210164.1.30931 WP_002210164.1.311 WP_002210164.1.31336 WP_002210164.1.31496 WP_002210164.1.31721 WP_002210164.1.31739 WP_002210164.1.31805 WP_002210164.1.32343 WP_002210164.1.32388 WP_002210164.1.32446 WP_002210164.1.32736 WP_002210164.1.33203 WP_002210164.1.33324 WP_002210164.1.33661 WP_002210164.1.33775 WP_002210164.1.33937 WP_002210164.1.34031 WP_002210164.1.34138 WP_002210164.1.35389 WP_002210164.1.35538 WP_002210164.1.36088 WP_002210164.1.37174 WP_002210164.1.37494 WP_002210164.1.37863 WP_002210164.1.38147 WP_002210164.1.38235 WP_002210164.1.38532 WP_002210164.1.38743 WP_002210164.1.38824 WP_002210164.1.38993 WP_002210164.1.39066 WP_002210164.1.39346 WP_002210164.1.3976 WP_002210164.1.40071 WP_002210164.1.40110 WP_002210164.1.40134 WP_002210164.1.40534 WP_002210164.1.40853 WP_002210164.1.41196 WP_002210164.1.41984 WP_002210164.1.42490 WP_002210164.1.44408 WP_002210164.1.44598 WP_002210164.1.44603 WP_002210164.1.45198 WP_002210164.1.45214 WP_002210164.1.46262 WP_002210164.1.46545 WP_002210164.1.46686 WP_002210164.1.46697 WP_002210164.1.46731 WP_002210164.1.4678 WP_002210164.1.46891 WP_002210164.1.47387 WP_002210164.1.47440 WP_002210164.1.47769 WP_002210164.1.47881 WP_002210164.1.48166 WP_002210164.1.48722 WP_002210164.1.4889 WP_002210164.1.49906 WP_002210164.1.4997 WP_002210164.1.50010 WP_002210164.1.50093 WP_002210164.1.50106 WP_002210164.1.50185 WP_002210164.1.50984 WP_002210164.1.51284 WP_002210164.1.51293 WP_002210164.1.51588 WP_002210164.1.51772 WP_002210164.1.51934 WP_002210164.1.52158 WP_002210164.1.52167 WP_002210164.1.52473 WP_002210164.1.52569 WP_002210164.1.52734 WP_002210164.1.52792 WP_002210164.1.52819 WP_002210164.1.52969 WP_002210164.1.53147 WP_002210164.1.53300 WP_002210164.1.53838 WP_002210164.1.53848 WP_002210164.1.53883 WP_002210164.1.53953 WP_002210164.1.54568 WP_002210164.1.54951 WP_002210164.1.55194 WP_002210164.1.55695 WP_002210164.1.5592 WP_002210164.1.56031 WP_002210164.1.56912 WP_002210164.1.56953 WP_002210164.1.57585 WP_002210164.1.57657 WP_002210164.1.58067 WP_002210164.1.58543 WP_002210164.1.58794 WP_002210164.1.59102 WP_002210164.1.59324 WP_002210164.1.59431 WP_002210164.1.5957 WP_002210164.1.59635 WP_002210164.1.5968 WP_002210164.1.59687 WP_002210164.1.59789 WP_002210164.1.59885 WP_002210164.1.60707 WP_002210164.1.60896 WP_002210164.1.61689 WP_002210164.1.62232 WP_002210164.1.62342 WP_002210164.1.6270 WP_002210164.1.6333 WP_002210164.1.63387 WP_002210164.1.63517 WP_002210164.1.63641 WP_002210164.1.64142 WP_002210164.1.64474 WP_002210164.1.64780 WP_002210164.1.64786 WP_002210164.1.64910 WP_002210164.1.653 WP_002210164.1.65400 WP_002210164.1.65554 WP_002210164.1.6570 WP_002210164.1.65706 WP_002210164.1.65718 WP_002210164.1.6581 WP_002210164.1.66546 WP_002210164.1.66616 WP_002210164.1.67404 WP_002210164.1.67850 WP_002210164.1.6791 WP_002210164.1.68361 WP_002210164.1.68371 WP_002210164.1.68855 WP_002210164.1.69018 WP_002210164.1.69316 WP_002210164.1.69951 WP_002210164.1.70171 WP_002210164.1.70319 WP_002210164.1.70377 WP_002210164.1.70417 WP_002210164.1.70726 WP_002210164.1.7083 WP_002210164.1.7169 WP_002210164.1.71744 WP_002210164.1.72280 WP_002210164.1.72440 WP_002210164.1.72486 WP_002210164.1.7402 WP_002210164.1.74131 WP_002210164.1.74310 WP_002210164.1.74577 WP_002210164.1.74738 WP_002210164.1.75169 WP_002210164.1.75173 WP_002210164.1.7518 WP_002210164.1.75208 WP_002210164.1.75337 WP_002210164.1.75407 WP_002210164.1.75636 WP_002210164.1.75821 WP_002210164.1.76555 WP_002210164.1.76670 WP_002210164.1.77295 WP_002210164.1.77387 WP_002210164.1.77429 WP_002210164.1.77569 WP_002210164.1.77691 WP_002210164.1.78004 WP_002210164.1.7841 WP_002210164.1.78556 WP_002210164.1.7939 WP_002210164.1.79515 WP_002210164.1.79550 WP_002210164.1.79609 WP_002210164.1.79825 WP_002210164.1.79981 WP_002210164.1.8009 WP_002210164.1.80331 WP_002210164.1.81848 WP_002210164.1.81877 WP_002210164.1.8210 WP_002210164.1.82133 WP_002210164.1.82151 WP_002210164.1.82270 WP_002210164.1.82436 WP_002210164.1.82619 WP_002210164.1.8303 WP_002210164.1.83039 WP_002210164.1.83102 WP_002210164.1.83265 WP_002210164.1.83630 WP_002210164.1.8420 WP_002210164.1.84720 WP_002210164.1.85269 WP_002210164.1.85270 WP_002210164.1.8559 WP_002210164.1.85802 WP_002210164.1.86034 WP_002210164.1.86059 WP_002210164.1.86413 WP_002210164.1.87107 WP_002210164.1.8728 WP_002210164.1.87418 WP_002210164.1.8762 WP_002210164.1.87853 WP_002210164.1.87988 WP_002210164.1.88362 WP_002210164.1.88472 WP_002210164.1.89359 WP_002210164.1.89542 WP_002210164.1.8964 WP_002210164.1.90176 WP_002210164.1.9051 WP_002210164.1.90624 WP_002210164.1.91263 WP_002210164.1.91373 WP_002210164.1.91844 WP_002210164.1.92030 WP_002210164.1.92331 WP_002210164.1.92604 WP_002210164.1.927 WP_002210164.1.9311 WP_002210164.1.9320 WP_002210164.1.93623 WP_002210164.1.93928 WP_002210164.1.93933 WP_002210164.1.94052 WP_002210164.1.94201 WP_002210164.1.94545 WP_002210164.1.94683 WP_002210164.1.95746 WP_002210164.1.95981 WP_002210164.1.97245 WP_002210164.1.97375 WP_002210164.1.97448 WP_002210164.1.97791 WP_002210164.1.97864 WP_002210164.1.97872 WP_002210164.1.97894 WP_002210164.1.99109 WP_002210164.1.99383 WP_002210164.1.9941 WP_002210164.1.99416 WP_002210164.1.99788 WP_002210164.1.99882 WP_002210164.1.99972 WP_002210164.1.99990 YP_002348415.1.25044 gi|294505346|ref|YP_003569408.1| gi|145600822|ref|YP_001164898.1| gi|170025987|ref|YP_001722492.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]