SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384123992|ref|YP_005506612.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384123992|ref|YP_005506612.1|
Domain Number 1 Region: 14-386
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.45e-101
Family GABA-aminotransferase-like 0.0000549
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384123992|ref|YP_005506612.1|
Sequence length 388
Comment TDP-4-keto-6-deoxy-D-glucose transaminase [Yersinia pestis D106004]
Sequence
MRVPRIGYAGDEMIPFNTPPIVGTELGYMQAAMSSGKLCGDGGFTRRCQQWMEKRFNCPK
VLLTPSCTASLEMAALLLDIKPGDEVIMPSFTFVSTANAFVLRGAKMVFVDIRPDTMNID
ETKIEAAITDKTRVIVPVHYAGVACEMDTIMALAKKHNLFVVEDAAQGVMSTYKGKALGT
IGHIGCFSFHETKNYTAGGEGGATLINDPSLIDRAEIIREKGTNRSQFFRGQVDKYTWRD
IGSSYLMSDLQAAYLWGQLEAAEQINERRLALWHGYYNAFKPLADAGRIDLPVIPGNVVQ
NAHMFYIKLRDIEERSAFISYLKEADIMAVFHYIPLHACPAGEAFGRMAGEDRFTSKESE
RLVRLPIFYNLTDVNQSTVINTVLSFFV
Download sequence
Identical sequences 349746.YpAngola_A0519 gi|162421595|ref|YP_001605116.1| gi|384123992|ref|YP_005506612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]