SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384124178|ref|YP_005506798.1| from Yersinia pestis D106004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384124178|ref|YP_005506798.1|
Domain Number 1 Region: 43-391
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.71e-60
Family AAT-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384124178|ref|YP_005506798.1|
Sequence length 402
Comment class I and II aminotransferase [Yersinia pestis D106004]
Sequence
MDDLNDGLRTPGSIMLGGGNPAHIPEMDTYFQQLCQEMLTEGKLTEALCNYDGPQGKDLL
LKALAKMLRDELGWQIEPQNIALTNGSQSAFFYLFNLFAGRYADGSRRRVLFPLAPEYLG
YADAGLDEDLFVSAKPNIELLPEGQFKYHVDFEHLNITDDIGLICVSRPTNPTGNVITDE
ELIRLDAIAQQRNIPLLIDNAYGVPFPGIIFTDATPLWNPNIILCMSLSKLGLPGSRCGI
VIADEKVISAITNMNGIISLSPGGMGPAIAAEMIERGDLLRLSNEVIRPFYFERVQQTIA
ILRKYLPAERCLIHKPEGAIFLWLWFKDLPISTELLYQRLKKRGVLMVPGHYFFPGLGYD
WPHTHQCMRMNYVPAPEMIEKGVAILAEEIERAFQEAKQLTD
Download sequence
Identical sequences A0A0M1VAN6
gi|292659869|ref|YP_001608102.3| 349746.YpAngola_A3792 gi|294505610|ref|YP_003569672.1| gi|384124178|ref|YP_005506798.1| gi|384128046|ref|YP_005510660.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]