SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tb11.01.1450 from Trypanosoma brucei TREU927 v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tb11.01.1450
Domain Number 1 Region: 4-109
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000437
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tb11.01.1450
Sequence length 596
Comment | organism=Trypanosoma_brucei_TREU927 | product=hypothetical protein, conserved | location=Tb927_11_01_v4:2575196-2576986(-) | length=596
Sequence
MVTLGKKDLLRWAAETTGIRPCSKYRDLGDGAVLLALALHVFPTSFPSGFASAISYQGKD
SAERNWDVLQNIMEQRQLPMHLFDRRAFSAGQARHCFNTLVLFYFLDRLKHNSHFCVDFA
NPVDPRVADFLQSPQSLTSIGKFSIPPSSSSPSPLVGASLCGGSAATVGIEQAGEDALVA
VGSSPVGLVASGRPPLRMTSPQLADGGVSQSQLSRMHMLNTQLREELDNVRATSHLLLAQ
QRVIVATEIAAMTEQLEAQLLLLRQQRDHEIRRCLREVREEYDTLLNEIPSTTRSDASSF
RVLSCSSGSNTSNTDGLGGLQRLFEGKFRNMQRELDMADSTIQQLRTAVNKQQERLEALE
DRIRCICSSTPPVNNEECTGFINNILEPLFGVAPRAVVETVGLRLKYVFSRMDALRCEVQ
RLRGRDGSESEAIPVSSIGQGVGGANNASLRQSVGAEKPPLVDAGNFCYQTAGGGGRKAD
EVPPSISGVGISAGTRDENFLACEGLRSKPRTLSMERTPLDTTTSPTIAFVAASGSTAVA
SDFGADEGDIFVVGGDAQPHKAKPTVPSSNSSVSLLSLEELERRKHEIMSKYGFSQ
Download sequence
Identical sequences Q383W1
Tb11.01.1450 gi|74024932|ref|XP_829032.1| XP_829032.1.54365 5691.Tb11.01.1450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]