SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tb11.01.2790 from Trypanosoma brucei TREU927 v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tb11.01.2790
Domain Number 1 Region: 73-196
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.7e-23
Family Calponin-homology domain, CH-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tb11.01.2790
Sequence length 493
Comment | organism=Trypanosoma_brucei_TREU927 | product=hypothetical protein, conserved | location=Tb927_11_01_v4:2883272-2884753(+) | length=493
Sequence
MTLEHNDEFATEGAMHSVDDPATTSSNGNTHRKPVELSSNAVHGKASGADVLDGNASAST
DGRTKPLNSGPTREAVDDVMMDECRRWVADVVGDAYNAEVLQKENFVDSLRSGVVLLVLL
QKLDDPPVPDSELRVPKRVDGFFARDNVAKFLRQAAKKFNLTEIELFTDSDLCDGKNDRA
VITCLLSIARTAYSRGNMEVAPASIVQQQELSVRIKQAALNQLRKHLAEEGEEDGKGEIS
KKLEPVAQEEVSHTPCENIPESGEPMKEIKNEVDVEAVVNESLADTEDYRSVEESEEADL
PDVPQHGEQMRVGEVADDDKSRPSGTYETTTRHAPVRVRIEGRASDTIKLPQHRTIRATK
ESQGVAITPVPHQVEQEVNAPQPRGMETQRHGPTAPPAYRPRRWDKVDILLSVVVNAHFT
QHPDTNIRFRRLSGNTGEYMVFHKVTGGKKLLHARTELGKVVVGEQRKKGNIEDLVWTDL
SHWLERHERDFSN
Download sequence
Identical sequences A0A1G4IDU0 Q383H8
XP_829165.1.54365 gi|74025198|ref|XP_829165.1| Tb11.01.2790 5691.Tb11.01.2790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]