SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tb927.10.10100 from Trypanosoma brucei TREU927 v4.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Tb927.10.10100
Domain Number - Region: 227-346
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0146
Family Calponin-homology domain, CH-domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tb927.10.10100
Sequence length 822
Comment | organism=Trypanosoma_brucei_TREU927 | product=hypothetical protein, conserved | location=Tb927_10_v5:2489194-2491662(+) | length=822
Sequence
MNSSGLVLELLCNLRWVLSYIVQRLDPIVEKHYGRTIEQAKRMESAVSRSFANAQSLSDL
PPEVLTLAQEGVVYLLVAEGVLGYCPPTMHSFLLRGASSCVSEAFSGCFSGNSSASSACS
KIHSTASNYQAQFLVVRWLTEEGILTDEELLDAMDEGGEVPLNKQESRFGLHMAMAERLS
VECSFSVQAHVVLTRSLLLYYCSTLITVEDVELHLNFLDPTCEKELTNMESALLLWLLCL
LKNMQRGGTINDQVFRELKGSADSLYKTVQSGTVLALVMSFYKPHLLPPSSIDARASNPS
EMLRQQQHFEHWGKTLRVAEELGLSPCLYADEAGQYGSVVLQLHVLRFIGELFAMLATQA
EDVEGFCAYAVRSQKLHASADCQRWCSMMGSDRSGGHADGSMNVNGMESSCETFRDAELS
QRKGDNEDSAVDHTRSINSSVVYSCFPSAHNRRQYDVMKASLLRSGENDMAAPKYCSSSG
KHCEARNVSSVEGHVDLGVEESFASEGLVPSASGAHRSPTAAPSYAGLVDSCRTRTRTSV
AKVWWSSDEGDVEVFSHSTSGTGNDVFLNSTIVQAPSLPSSGCANSSVCMQQRGWKPRDS
SLHPPAPFNIEESDGSGASPRFGHSDMLSPLSSTACEAEVVVGIDGSRITSENSFRINTV
ERGYTPQASSSGLSPLTPVETTDRGTIPVDMAIQKNNDAKNGTFPRAPHSGAREQMQNCP
PNDESDDDALLREVYSLYPALPTIDSRQKLLETLEHQHVLIKRLTQKLLEAKKASPSPAG
LAPPEVADPNRTLPSIMNKAKERFHHESAAGRMGNEKMNSEK
Download sequence
Identical sequences Q389W7
5691.Tb10.6k15.0180 Tb927.10.10100 gi|71748352|ref|XP_823231.1| XP_823231.1.54365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]