SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tb927.10.3130 from Trypanosoma brucei TREU927 v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tb927.10.3130
Domain Number 1 Region: 4-109
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000704
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tb927.10.3130
Sequence length 784
Comment | organism=Trypanosoma_brucei_TREU927 | product=hypothetical protein, conserved | location=Tb927_10_v5:816824-819178(+) | length=784
Sequence
MNVLIGKRELFAFAERYSECRIKEYAELADGAILCSLFAAVFPNMRIRTATSQTHTRSQL
AHANWSALRKALSAVGIPPSLLNRERLQCGDAESGFSALVLFYFLFHLSRRSDFSAEFAA
DVSEELTEFLQSVDSIAALVAGGAMSLSAVPLPLQEQLRGAIMRTREGCGLPEGGKESGR
SCGDTGLDTACPSSVVLAVQMDGGDNENNEKTTSDDLKRPPSFSSPEEFAERKDDRVPQE
TGGNEREVHSGYSVCRKWKQDDRECEEAYDTIDHCDSCRGGDAGYRRMAAGVAEEVGDEL
MAPIFQQNRDLQELLMVKEKKCEELKAQNLELLGHLTKLRIQYSMEKALPWQGDDTANES
TKVEKGELLASEEVQHLRSVLQTTRSERRRLAAKDGVPIDELLGGIVDAETGEVIDVENE
ATLLNGVLADVLRDIPRDRREAQRCLWRIVSAFNVLEERLAVAVGTQKPNCERVKREANT
IFGDDGGECGSPASVFRPPTTPCTTAKLVESCDDSSMFDLKAPADPSLSPENIFSRLKEE
MILRQRRFERQLIQLHDNEARLQKRIHVLQNKICHLCQRSLERDLTWKSLCAAICEAERT
SLLVADAESEEAVERLLEQRNACYIRADEVSASLMRDQEEQGDALIMPGGHENDCHDVCE
TMKVLLESVTQDRDKLLKELEALQDVGETGRNQRTEHQQRLSKGDLRKSVRTLLQEEGHS
SNGEWFAQTSTFFPFASSPSKLVLKNSVSAAQQEDGRPLHGGRCPLPPGENLSALLSLPG
VIGR
Download sequence
Identical sequences Tb927.10.3130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]