SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tb927.10.620 from Trypanosoma brucei TREU927 v4.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Tb927.10.620
Domain Number - Region: 37-105
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0111
Family Calponin-homology domain, CH-domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tb927.10.620
Sequence length 534
Comment | organism=Trypanosoma_brucei_TREU927 | product=hypothetical protein, conserved | location=Tb927_10_v5:164627-166231(+) | length=534
Sequence
MEFPQVTCDDVNALVQMCSIPHETAITSLKQCSSSLFVLLYQRLFNCTIVGIESSPYTVE
QKKWNVKCVLNELCAKCGMNVEGIDAEKIVQLNEEHISRLIALFLEIANRMSIHTGAGRG
ALPVGAGLTAPTPFPAAALRPKLAEVPRDPAEDGTWYPPAAATHVLPTHLMRPVHAAEGH
MRAAVQAYLHHNESSYRGHHDSAQLGDAVDSAHEKHKDNHDSMRSGRKFYADVVEAEMSV
SDVANSGDDDKATLLDEEDDGGSGGSFVNTEEKEIPTSQLVEVWSAQVIPPKRHIGMGDS
PDLTELRGQLTAMDKCLRRGEQRRVRLRHQQRQQSAAQNQRGHMDPVSDGVSAQMWRDRR
AIASAFLPHGLNVDTIKGNKFYEKQPRRMIDYERRNEKIEMLRSVRFIDELEREVGRKMV
QQHRDTTMKLREEVKAALERDRQEVLERRRLIREEDQKYRNAYTAILTAASNDLRMTKVL
MLERMQHLAQQHALSLRESRRMCQLLKRESKERVRHDLLRYASAVTEWQSHFVI
Download sequence
Identical sequences A0A1G4IH03 Q38CH8
gi|71746530|ref|XP_822320.1| 5691.Tb10.70.7600 XP_822320.1.54365 Tb927.10.620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]