SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tb927.4.3130 from Trypanosoma brucei TREU927 v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tb927.4.3130
Domain Number 1 Region: 8-108
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000432
Family Calponin-homology domain, CH-domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tb927.4.3130
Sequence length 275
Comment | organism=Trypanosoma_brucei_TREU927 | product=Spef1,flagellar component | location=Tb927_04_v4:824258-825085(+) | length=275
Sequence
MSVPLTEEDLHDLYVWVDEIPISRPKRNITRDFSDGCCVAEVMKFFFPKLVELHNYVPAM
SQSKKIENWNTLNNRVFRKLHFEVARDEISDITAGVPGAIERFLRALRTKISEIKARREE
LAAAEALTGVPGTGLSPSRFRYGARHADRAGTAGSTLSAHDRNVENEAERGQRGGSKVGV
TSGYANTQGRSNAAPNVKSGFDQRNGSARTSGSVDDGIDSRTAASLRQLFDEKDRTIAEL
RETVGLLSEKVMKLEELVRLKDNKLHDYRSTFGHM
Download sequence
Identical sequences A0A1G4I5W1 C9ZMW0 Q52WZ6 Q583Z0
gi|72388078|ref|XP_844463.1| XP_011772902.1.14543 XP_844463.1.54365 Tb427.04.3130 5691.Tb927.4.3130 Tbg972.4.3140 Tb927.4.3130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]