SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tb927.6.620 from Trypanosoma brucei TREU927 v4.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Tb927.6.620
Domain Number - Region: 2309-2372
Classification Level Classification E-value
Superfamily PapD-like 0.000209
Family MSP-like 0.033
Further Details:      
 
Domain Number - Region: 1564-1679
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0267
Family Calponin-homology domain, CH-domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tb927.6.620
Sequence length 2728
Comment | organism=Trypanosoma_brucei_TREU927 | product=hypothetical protein, conserved | location=Tb927_06_v4:251004-259190(-) | length=2728
Sequence
MATEEPVSDTKKSNGVTPRKQISHTVQTLTSNSSEGSIHVHPTQGYYANFDVDTVYVIPF
TVRNLSREICALRFTHPNNQTVFRIKTDSVRLAPGLTHVIEAEFFTHTSQDYEDSFVVFT
DKESITIPLVAKCFPDVEFPLTLDFGTVERNTRGIVQSLAIRNPGRRVARVHIVPEGESA
ASALRVRTANCDVGPFSEGNVMVELLSPLVGRHKFPLTVTVDGEAKTRTVTVTVEVIDCR
GTLLNANTGEELHSLMFPKTYVGAKRTMELIVRNDSRQSVSFAFQLLSDGNTEDIPPFSF
VPQQGRLGPREKKHVTAIFAPMRSKEKATGWTCRRDQQTAVNETFEWLYSLLFVETEHTH
TLRATGTSTTTVAWLSQTVVDFGECAMNDYRDFVLQVHNGHKDAPLYFKFPRIAHFHISP
DEGNVSAAKSVPVRLTFHPRRLGNFSERFNVVFNNTETTPLTVVGVATKIVPQQKRIGGI
DKLPQDFERTMKAIEPVAEPYVAAAPPETYANLDDVDLGMVPAEGLRPIEPELVAPIGRS
RSAGEMGGLGAGDHLPLVTLDVKTLIRKVYKEAPSNAAERRDCKRELQPMELLRIVAPVK
VLEFHRVTVGSTATKPFFLYNATSAAVLATMPTDEEHLSFSPQAQVIPPGRSAVFDVTFR
SQVVQVLQQVMQITINGRHLLRFTMQADSVPVEVSLSREEMVLHFSNFSEEPVARSTVVL
SNNGNSEAVYSWALQLNNAGTGSGKGSGSGPFAIEPMSGTIPPMSKVTAYVSFSPPYGII
TASACARLQVERSDGVKTLNITGAVPVTSCAWGKCTTAGGTPVVSPQGKKDWNKHHSATE
ALIELQKVPAGRGTRASITLHNKGKNVAFFTFDGVPSWLTVSPESGRVGPRESEEISLLV
YHEKPEALRTVMNCCVRGIKKPLKLTVSVDVCAALLEVITPHRQNTEAILDFGMVYIGTE
KALPVRFKNTSDVDGVILVDLRQHMEFAVECAADVDSAAIHDATVTNNNSTDPPTMLQWC
GPGEREPGMASIIIPPCSELGVLFVYRPVSTAEDGGRFFVSWRHVGTDIKNPLVPLVIIA
QALQSRVAVTPRFLKFPCTVVDSPSVPATVTIKNTSSVSVHWRLQPIRNNEDSPTAEGRT
PLSPVSSRVSSFVMSISGGVLAPHASEQVSVTFVPDGVGNWRELYGIYVDGDLLRHCADL
SMSGFAALPRLLCDVEELAFPPIPLNITVRRRIIITNDGFDHINLSYHTIDSGPLTITFP
NGTSTGLMGRIPVEIEFCSQWPVSAVSSIKFSSNKGETLTLPFRGAAINSFLTNAPYVIQ
NANISKIASSRGDEEWKEPLIYREIDSWQLAADGGGHKVRKVGGETQYVRSNSVKPIPPR
YLEPIAPEFYVRCEESLRLWLNYNVFLEPVANLVTALQLSDGRLLLDAARRMGVKKQSRA
PDSSESTTSRTLVTLESLMSLLKLNGGCLSEVQIIYLMTYEAYCRHQKEVNAEAIPLANF
TERSTHCWTVVVLQFIRVVYFAKLRIDSMLAQYPSLGKYMPVEELQAGSLSTAIYGSNVF
SGMENILLYWATYNLRQCIKKGMLKDTRAPIRRFEDLRDCVAVAACIFVFVPSAAAYVSA
DRFVPETVTQSDLENNISLLTNALVYVGFPSSFSSVEQILQYGPLDWLLLLSTLFHYLPR
FIPTGTIVLKGKLLSPATHTIEVKNTSNTVRVYTVEMSNCSFRAVPREFTVDPGGTFQLQ
LEVTLRFNRRLEGECVLVDSAQNLVKERMPLVFHLVALPSEEPLRTVHLQAPLYTVVHQE
ICVENPFAQNYVATLRLSQEYKNDGGYSEGEFGKLQQGAFYISAGVVSFNVGEPTKVSVQ
FAPCARGQYEAQVTFHDVQLGEFSIVLIGTCIPPKPIEKFVTRAEVGEACNNTVMLKLHN
QQFERMMNTVEDCNRFPSSRVVKGPSMPELTNIPYSVTFVNESFVGPSPFFIGPESIFFT
RGDQMLELQFSFCPKVVGDYNGYIILASKYDVRTILLHGKGIPVGEKSILRFSCPARQSI
VQRVPIVNNTKESWLITATIEGDCFSGQKEVRIPRGKSREYLLRYNPAWVSSDTGTLTLH
NRETGERRTFMLYGESVEPLCEDVITVECRAREKRIETLTIPDINNMDGNYTVETDLPFA
TGKPTVLVRRGTNAKYDLILHPLMGGTFNGTVVCRAPNGHFAWYGITIIVSAPEKEGTLN
ICTDTRTPVTAYVSIQNPMDKTIDFTVGRYGVGLFGENSILVEPSEPSVYSLLFLPSRTG
KFPGRLTFFNKEVGEFWYELDIVVEDAAPEEVAFSSEIGVPQTVQVRIPNNTPNELPLCV
TNTNHDNFSVVPSNPRVPPYSELTIDIVYKPTAIGRPQEAMIKLLNLDSAEWCYHCRGVG
HAPAEFAPVECVCEALGRVSVVLKFKNPFSVPMMPDVEVKCEEMNYYSAAAQSLPGTPIA
PATEASIVVMYEPKTVGRHNATVLVKPKFLSEEVQDMTWVFPLKGLAEWRSHDQPLRFRC
VARKKVEETVELVAPGMTAANLSNVTITLDLERGQQYASAVRNSLFFKVHPTVEVEGMLK
LDIRFVPLRPFVAMADLVVRAEKESVWRYSIVLEASRADVDDTLVVKSTLRAVSTITFDI
YNIYPHSSPFTAYFTPDSSRDFSVGVPQGVLPPFIIGQRNANAATTMQVLFSPTARLPQP
EGTLIIDTEEMQWIYKVIGKVSGRPIHP
Download sequence
Identical sequences Q583U1
5691.Tb927.6.620 gi|72389781|ref|XP_845185.1| XP_845185.1.54365 Tb927.6.620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]