SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tb927.7.4600 from Trypanosoma brucei TREU927 v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tb927.7.4600
Domain Number 1 Region: 378-485
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000000209
Family Calponin-homology domain, CH-domain 0.0044
Further Details:      
 
Weak hits

Sequence:  Tb927.7.4600
Domain Number - Region: 293-326
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0235
Family RILP dimerisation region 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tb927.7.4600
Sequence length 943
Comment | organism=Trypanosoma_brucei_TREU927 | product=hypothetical protein, conserved | location=Tb927_07_v4:1221082-1223913(-) | length=943
Sequence
MVSRAKHPCSSSLPPIVFPSGPSATYAAFSQKEDAALDARNKIERHRYAKLLLEYAERYR
EFSSVSFFVETMLRELAGREGVTNQSRAMAAVWSMKLLSCHSPFKQFMVHITEALLPAIF
CNYDAKRLDYAPAAIQALLCDRALHRDNPFFSHSTYMHEYDASLLKLKNISGELKRVSFT
GSEWKRIAHMLVVYVQSERKRRAFIAWRDNVKKERVVNKLRRNVVSRHGADSRFLCVALG
FLRWKSATAMSRVQFLTERLHDAAFQLESAKNQFHMECFRADKLQLSNEEKDSELKAVMC
ERDELQLEVERLKEQLKIQERNHEANLRARLLEILTLAQHQNILLKKIVGTQFDAKEVVA
GWLHKEDGDYQEREPEHGENEALQGHSFLLRWCNHILRSGEVGVLRRVRNFADDFADGEV
FHGIIRYVFPEKKEFATSVDSSVADRLRLVCDFTTNIPLAVSLTVEDFNMKREDRIIVAV
AEIFAYYVEKKRADAVSESFRLVVEQDPLQVDSSIATDSEDVSLLTTEEDVKKQLSIWNK
ELSKQVENFRLGVWCEMDLQKSGMCISREAARLTWERGRGHPRYVVTADASRHFVSLNAR
KMNDLREKFGSCTPQVWRSVVQSLKRVLWKHVNTITSIFYHYAGENAHEMDEVQFWRFVE
DSRLMVEPLSRQTIARIFDTVISPKLMAMLQAKSVEKQAALLEAAEEEMNIRRVKPAQFT
EILLHMGAVRFRDSLLDAAGRFLTGLSVPTLCGVTPTTVDFYRPESQRVIRHLQEDLARV
FFFYVKQQSENQRKSSKGLKQPSGRFVGRISFDAYLRMFSDCGFVADNKEKENNSRRGST
EPHRYCRKVKFTDVEEITETFNALHERVLLLPEGELCFSLFLESFGIACQYWCPDPKVSF
PRKLACFLTDMIERLRTLHSRSALILRELPPPTVEKGDAGCVP
Download sequence
Identical sequences Q57X76
XP_846083.1.54365 5691.Tb927.7.4600 gi|72391578|ref|XP_846083.1| Tb927.7.4600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]