SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tb427.05.930 from Trypanosoma brucei Lister 427 v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tb427.05.930
Domain Number 1 Region: 43-341
Classification Level Classification E-value
Superfamily ApbE-like 9.68e-53
Family ApbE-like 0.0024
Further Details:      
 
Domain Number 2 Region: 378-651,804-875
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.05e-48
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00011
Further Details:      
 
Domain Number 3 Region: 640-804
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3.89e-34
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00027
Further Details:      
 
Domain Number 4 Region: 1002-1129
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.14e-27
Family Reductases 0.001
Further Details:      
 
Domain Number 5 Region: 889-982
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.000000000000238
Family Ferredoxin reductase FAD-binding domain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tb427.05.930
Sequence length 1142
Comment | organism=Trypanosoma_brucei_Lister_strain_427 | product=NADH-dependent fumarate reductase | location=Tb427_05_v4:309692-313120(+) | length=1142
Sequence
MVDGRSSASIVAVDPERAARERDAAARALLQDSPLHTTMQYATSGLELTVPYALKVVASA
DTFDRAKEVADEVLRCAWQLADTVLNSFNPNSEISLVGRLPVGQKHQMSAPLKRVMACCQ
RVYNSSAGCFDPSTAPVAKALREIALGKERNNACLEALTQACTLPNSFVIDFEAGTISRK
HEHASLDLGGVSKGYIVDYVIDNINAAGFQNVFFDWGGDCRASGMNARNTPWVVGITRPP
SLDMLPNPPKEASYISVISLDNEALATSGDYENLIYTADDKPLTCTYDWKAKELMKPSQS
NIAQVSVKCYSAMYADALATACFIKRDPAKVRQLLDGWRYVRDTVRDYRVYVRENERVAK
MFEIATEDAEMRKRRISNTLPARVIVVGGGLAGLSAAIEAAGCGAQVVLMEKEAKLGGNS
AKATSGINGWGTRAQAKASIVDGGKYFERDTYKSGIGGNTDPALVKTLSMKSADAIGWLT
SLGVPLTVLSQLGGHSRKRTHRAPDKKDGTPLPIGFTIMKTLEGHVRGNLSGRITIMENC
SVTSLLSETKERPDGTKQIRVTGVEFTQAGSGKTTILADAVILATGGFSNDKTADSLLRE
HAPHLVNFPTTNGPWATGDGVKLAQRLGAQLVDMDKVQLHPTGLINPKDPANPTKFLGPE
ALRGSGGVLLNKQGKRFVNELDLRSVVSKAIMEQGAEYPGSGGSMFAYCVLNAAAQKLFG
VSSHEFYWKKMGLFVKADTMRDLAALIGCPVESVQQTLEEYERLSISQRSCPITRKSVYP
CVLGTKGPYYVAFVTPSIHYTMGGCLISPSAEIQMKNTSSRAPLSHSNPILGLFGAGEVT
GGVHGGNRLGGNSLLECVVFGRIAGDRASTILQRKSSALSFKVWTTVVLREVREGGVYGA
GSRVLRFNLPGALQRSGLSLGQFIAIRGDWDGQQLIGYYSPITLPDDLGMIDILARSDKG
TLREWISALEPGDAVEMKACGGLVIERRLSDKHFVFMGHIINKLCLIAGGTGVAPMLQII
KAAFMKPFIDTLESVHLIYAAEDVTELTYREVLEERRRESRGKFKKTFVLNRPPPLWTDG
VGFIDRGILTNHVQPPSDNLLVAICGPPVMQRIVKATLKTLGYNMNLVRTVDETEPSGSS
KI
Download sequence
Identical sequences Tb427.05.930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]