SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tb427.08.1950 from Trypanosoma brucei Lister 427 v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tb427.08.1950
Domain Number 1 Region: 81-233
Classification Level Classification E-value
Superfamily ApbE-like 0.00000889
Family ApbE-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tb427.08.1950
Sequence length 710
Comment | organism=Trypanosoma_brucei_Lister_strain_427 | product=hypothetical protein, conserved | location=Tb427_08_v4:627425-629557(+) | length=710
Sequence
MLSWNPESYVSEAVSRILAEEAKQGRGGAIPSYYDAVTSHLEAHELSKSIKVALEEQRRQ
NIGISCDIGGNVLEILFNPVDIEDAGVAEERVKKCVADIGCLFGNVSDELNSLNGKSGLV
AVSEDVLDILHHLQSMGLLTNFRFNPVSEKLGCILSATDRSSILKSMVLYNSQVEWPKGM
TLNFTDYMKAWLVDRVAARLEVLNEHRGCLIRLEDFARVFGTSRGSSVWKYGVSVSDLDG
EQKFIGCLELDALRPTAAAHAVEDPFFDHLGMQSCVACCRTTTTSYCLANALSVCSHGEK
ALFFVREWREVNGPESKNSLLSFTLYFGYGKPISDEGDVRIGENDDKRIYLHSEKDQIVR
TYKQMGDVKRYESHVETVIANSKNADLFHNISGYIGETTCENLERAMSLFPRMCVVAXCI
GNENAVCVSVLKAADVLRGDATFVFCISQRSPLFNHVFAPRSQVTLNFLFDNAQAVCQAI
NDTYPLWINETGNEPVVFESESRTYVTTKALMDISKQXAFETAESFLVGEEVLVVGRCLD
SIPSTVVINVKNTLVLQDHVPPQEFYPFLFTIVHKIYGTVGFVGYGCQLCSLSPLTMYIY
SPIESSQFALDEVYTGPKCNLTFLSSFGAPIFDGKDFEELGCGMPMAASSVSSLPQQNIY
FQVEGMLIRIVRDISDKYVICVVAANECRFNQTDPCKLLVRPDDXRLIPA
Download sequence
Identical sequences Tb427.08.1950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]