SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tb427tmp.01.2780 from Trypanosoma brucei Lister 427 v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tb427tmp.01.2780
Domain Number 1 Region: 2-372
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 9.21e-112
Family IF2B-like 0.00000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tb427tmp.01.2780
Sequence length 386
Comment | organism=Trypanosoma_brucei_Lister_strain_427 | product=translation initiation factor 2 subunit, putative | location=Tb427_11_01_v4:2882219-2883379(+) | length=386
Sequence
MSSAHNTLESIKYRRGVLQLLDQRRLPLETVYCDITSIDDICCAIKEMRVRGAPAIAVSA
ALALAVVAERELKEQRQNSVWKTADDMRQFLLMSCDKMMSARPTAVNLSKVLIQLKKDIE
TDKANTMEAVLETCVQLAEKIYAADVSFNERIMRHGAAHLLKLASKERVNILTICNTGAL
ATSRYGTALGIVRQLFYEGHLQHLYACETRPWNQGARLTVYECVQENIPCTLICDSAVSA
VMKTHDIDAVVVGADRICKNGDTANKIGTYNLAVAAAYHKVPFFVAAPSTTLDPLTPDGE
GVVIEEREATEITHIASGGGGLQSDKSNSDYGRKRVVADGPHLKVWNPVFDITPASLITG
GIITENGVFPPATAGPLFDISRIVEP
Download sequence
Identical sequences Tb427tmp.01.2780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]