SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tb11.39.0006 from Trypanosoma brucei TREU927 v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tb11.39.0006
Domain Number 1 Region: 217-310,353-517,545-617
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 9.21e-63
Family IF2B-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tb11.39.0006
Sequence length 628
Comment | organism=Trypanosoma_brucei_TREU927 | product=translation initiation factor eIF2B delta subunit, putative,eIF-2B GDP-GTP exchange factor,guanine nucleotide exchange factor subunit GCD2 | location=Tb927_11_01_v4:520637-522523(-) | length=628
Sequence
MSSAVGAAMSLIGQDSDEARAAVRLQRELKRRKDALRKLEKKMKALKPSDTVFQVTMEEM
EKLKNEVDQLEKGVASQQEEKKSSVESKSPRRGTSAAPRLVGSPRKDPLKSLTPRGAGVK
TPKALSTPRIRRDLAPSAHTSRQKAVSKEERRAGYVTDDLGERVAVTVSAGTAGSQMRDE
QLFVDVQAVVQEHIDRSVTGSPCAIVSPRNDIDCEGVHYQVAELALMMESMMVVGGNART
FAMIEAFKALLKSSPTLSGSTVNHFPSKEFESLIKVNFDFLCRSRAPSAGMTNAKDSLVR
RVVALLSQREKARFSADDLFASLRSARLESSMCVQSTAVGRDRNETCFLDISPRDLALKV
LGAIERELQLSIKSIVEDRAEPHLSSNDTILVFGRSSTVELILLAAANNPRLASKPKVIV
VDSAPLYEGRALATRLSCSGLDVTYGLITTCCTLMPRCTRVFIGAAAVLQNGDVFSRCGT
AVVVSSAKQFRKPVLCFSESIKFVPEVWLGNLGQNTRLTDMRQPHRGELRIRSPGNWSPL
SHGSRELMDVKKGWGQCNSGGLSGRGTNEEPSRLLQTDAPPSSGYLYDLTPAAYIDMIIC
EMGCLHTSAILAALRDREDRDLYLMSAT
Download sequence
Identical sequences Q4FKA6
5691.Tb11.39.0006 Tb11.39.0006 XP_828269.1.54365 gi|71754709|ref|XP_828269.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]