SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tb927.8.4950 from Trypanosoma brucei TREU927 v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tb927.8.4950
Domain Number 1 Region: 134-482
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.22e-90
Family Motor proteins 0.00000552
Further Details:      
 
Domain Number 2 Region: 1038-1273
Classification Level Classification E-value
Superfamily Tropomyosin 2.29e-19
Family Tropomyosin 0.00019
Further Details:      
 
Domain Number 3 Region: 840-1058
Classification Level Classification E-value
Superfamily Tropomyosin 1.53e-18
Family Tropomyosin 0.00017
Further Details:      
 
Weak hits

Sequence:  Tb927.8.4950
Domain Number - Region: 646-752
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00188
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number - Region: 1339-1444
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 0.00837
Family Variable surface antigen VlsE 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tb927.8.4950
Sequence length 1456
Comment | organism=Trypanosoma_brucei_TREU927 | product=kinesin, putative | location=Tb927_08_v4:1463533-1467903(+) | length=1456
Sequence
MEYKRCNSSRTTASISRSPQLRTSATSTPVRSATPMRTPTSARSGASSARRTLTGTGTGS
GALRSVGLDGASPRAKGPGLPRPIAYKRSGTATSGGQVDSGNDMSMVSSRSAIGDSPKGK
RGAHKPAVAKTGGNGRVNVYARVRAFSPAETADNQHSAVHLSDNKVEVVVSPKSVYTFML
DGCFSSTGSPSDEGFASQSSVFDAIGRPLAENALAGYNAAIMVYGQTGSGKTYTMFGPPK
SLGTEEQGLVPRVCNMIFERADACLQKGITCRVCVSMLEVYLEDVFDLFSNRKQVTVRKD
YLDNSFHVVGAKSIPVRQYKDVEELLQRAEALRTFAATAIHARSSRAHALFQLELYTTFE
STDIAPRTAKILLADLAGCERIKLAQTETGIPFEEARNINLSLLSLGSCIEAVTMRKGSS
QNIPEFRNSTLTKLLKEYLGGNSVSSIVVTVGPSVRDARLSVQSLRFADRAMKVVTHAKI
NTVKPITELDDADGSEDKVREAYNKKKEALQVEFQVQSELQKLQNKITILECQLMNSVDD
EVVARLQEEISTYQKSLADADLELQQQRRVLYDSEVMLEEQLKELNTRMQEMIEENEEAT
ENLLAECRKKHTERLEVEQKRHEEEVDVLLKSHEFELERINQLLQDSDTKCAELTTTLFK
TKEDLRKTDGLVDEMQMALEELGDASKATETELYGYVEQLRSENSRLSTAIDTLRQQLKE
SEASVEDRDNRLKEHEESLDTLRQQLKESEASVEDRDNRLKEHEESLNTLRQQLKESEAS
VEDRDNRLKEHETSLDTLRQQLKESEASVEDRDNRLKEHEESLNTLRQQLKESEASVEDR
DNRLKEHETSLDTLRQQLKESEASVEDRDNRLKEHETSLNTLRQQLKESEASVEDRDNRL
KEHEESLNTLRQQLKESEASVENRDNRLKEHEESLNTLRQQLKESEASVEDRDNRLKEHE
ESLNTLRQQLKESEASVEDRDNRLKEHEESLNTLRQQLKESEASVEDRDNRLKEHEESLN
TLRQQLKESEASVEDRDNRLKEHETSLNTLRQQLKESEASVEDRDNRLKEHETSLDTLRQ
QLKESEASVEDRDNRLKEHEESLDTLRQQLKESEASVEDRDNRLKEHEESLNTLRQQLKE
SEASVEDRDNRLKEHEESLDTLRQQLKESEASVEDRDNRLKEHETSLDTLRQQLKESEAS
VEDRDNRLKEHEESLNTLRQQLKESEASVEDRDNRLKEHETSLDTLRQQLKESETTVVVL
TADLKQLEEEMFIDQADLKERIAFLEVELKRCEEKGAYYSALVDEMQAELHCANERVAAM
SDQVQNMEVRVFDVCGYMFEAFSVKCQDTVSAFASFTKGVTEDLTKGTTERLRLLAEVVE
LRSSTVARKAATQRRASAVSSLVQSAQEILSKIADEVEDADNFSDRSAVVASFVNSPKES
WGADLSPRFTEESLTC
Download sequence
Identical sequences Q57UV7
Tb927.8.4950 gi|72393049|ref|XP_847325.1| 5691.Tb927.8.4950 XP_847325.1.54365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]