SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc00_g018950 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc00_g018950
Domain Number 1 Region: 164-429
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.73e-51
Family Extended AAA-ATPase domain 0.052
Further Details:      
 
Domain Number 2 Region: 488-694,737-895
Classification Level Classification E-value
Superfamily L domain-like 6.12e-37
Family Polygalacturonase inhibiting protein PGIP 0.066
Further Details:      
 
Domain Number 3 Region: 1269-1593
Classification Level Classification E-value
Superfamily L domain-like 4.08e-28
Family Leucine rich effector protein YopM 0.055
Further Details:      
 
Domain Number 4 Region: 1750-1864
Classification Level Classification E-value
Superfamily POZ domain 7.46e-21
Family BTB/POZ domain 0.0047
Further Details:      
 
Domain Number 5 Region: 1032-1163
Classification Level Classification E-value
Superfamily L domain-like 0.00000000578
Family Ngr ectodomain-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc00_g018950
Sequence length 1937
Comment Putative disease resistance RPP13-like protein 1
Sequence
MVALRFDGLPGSIALLLDKIHSVLPLAAIIEDTTFASLLKRLKSSLASISDVIHDAVGPR
RNSHGMYDWLHQLLYTVFNAEDFVDDILFEVARLKVEAKARNLESLELRDVRASIKNLVL
SQDRRPRWNIRNLVETTDAIAKAMNEYCIRKREANDELQLSDSLPAISLLDEAAIYGREE
DRINILRFLLQGAENLDGIALVDEGGLGKTTLAQLVYNDEKVSAHFKLKAWVAVPMAFDL
YKITRTILEATTLCSIEDLMSLELLDKLSASLDGKRFLLVLDDVQYLNNNVWYALRTSLN
SGARGSKIIVTTPKEEVAFVMGCSTLYHLNPLTEDFCWSLLAKSAYAGRDRSEVITLEDI
GRKIMESCRGIPLCVNVIGGLLRFKKTREEWCHVLEDLQKANNHDSISSILLLSYYHLPA
LLKRCFAYCSLFPRDHEFDKEELVLLWMAEGFLQKSSGPSMEMVGAECVDGLLKRSFFIP
VDNSHFKIHHYMHDLAKAVSRGVCLRWESCTIIRSAIPKRIRHLSLLSQYQLRVILEMKS
LRTFYLIDCRSCQLSPKALEAIFPGPQRLRVLSLPHFQHAELPPSIGKLKYLHYLDVSHS
AVTSLPEYLCTLYFLQTLILTNCYSLLMLPQGIVELVNLRKLSIKGAGLKQMPEKMSRLT
SLQSLTNFIVGHGGSSIKELGALPNLHGSLSVSGLQNVSSPSDASAANLKAMRYLDELEL
EWSCNNEDPATDQKKALEKLKPSVELQKLSIRFYGGKEFPKWLGDSSFSKIISLHLSDCI
NCKSLPPLGRLSSLEHLIIERIGRIKSIGHEFYGVDVAGCKPFQSLKTLKFVEMSQWEEW
ILLEVDGQEFPCLEEFCVINCPLLKRDLPKSLPTLVKLEICNCEQLEASLPQTSECCVPK
LDNCDKVKKISNDNQTAPSSSEDRNQQFSSSSSSNKKLREPLDLRGSLPKSKFQDVSSAS
DASEANLKAMPYLDELESEKTTQDKTLSKIDGEIASEFSSRMTKVPGNELQLEWSRNDEN
LAKERAVRWSEVSALSTIRFLCISDYNNCSSLPPFGQLPFLENFIIQRIGGVRSIGPEFY
RIDLTFRKPFQSLKTLKFGEMSQWEEWTLLEVDGEEFPCLEEFYLINCPLLKGDLPKSLP
TLVKLEICECEQLEASLPQTSERCILKLDNCYKVQKKTQHKTLSKSDGEIASQFSSSMTE
IPDDELQLEESRNNKNPAKEKAVQEYPEPSRKLEEPSKSDGEITPEFSPSLIHQEQDHNQ
PTPSPSEDGNQQLMELPTDLHSLRIEGYASDKLPKEILGRSSLQHLYIIDCISLQSFPQS
PSLKTLYVHNCQKLKFPQPNKVMNQDVGLEDLCLGSSCDSLKIFPLNYFPKLKSLSLWDC
RNLEHLSIEKGLQNELTSLDSLEIKDCPKLRSFLEEEFQAPNLTSLVFFNCGSLKSLPGM
QSIKSLQSLYINKCPALESFPVEGLPSSLIILSISFCDKITPQKGWKLENLHSLSHFEIE
GGCHELESFPEEGLLPTNLNSLRISRLADLKFLDREGLQKLTSLQTLEINCCDKLDSLPE
HGLPSSLYSLSITDCSLLNPKLQNRKGREWFKIARVPSIHLDEVRECHLLVVGSRIGKQI
VCGLVLDLLSINAQFVHAKTWNDILLMMQRWDQERRQELARQAGLGKKSRKSRQEMDCSI
CSSMPFILRPPRNTICGACYEGARNVITLMNKLDQNDGKGSDKPQPLANLTKWIASMKDI
EDDLNKKISFLSGLLVAFRDQIHTDIQLKPGNHGPCIPAHRALLAARSEIFRNMLDSDGC
KAPPSDTITLPELNTEELESLLEFLYSGNLPFDKLEKHVYSLFVAADKYEIPYLQEFCER
FLLSSLNASNVLEILEISDVCSNKTLKETALNFIVRNMEDVVFSAKYEVFAPKNPHLGVQ
ITRAFLMDSKSKRINGV
Download sequence
Identical sequences Tc00_g018950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]