SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc00_g030910 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Tc00_g030910
Domain Number - Region: 375-408
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00165
Family Rho termination factor, N-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc00_g030910
Sequence length 415
Comment Putative SAP-like protein BP-73
Sequence
MFALSRSRAQMVFFIEQSSHPSSGDMGVNDLGFVTVVVLGVEDWWNSSYGTTECRYLSCS
GISGRAVTLSPGSSRRDHRICSQVKIRSLKCGSKEISFVCRAGSSGHRRNPDFSRQRHGF
RGRNRQNEDRENFESIDESEMLSSKNGPLLSLSGSTKFQATAVPGPREKEIVELFRKVQT
QLRERAVAKEAKKTEASQGKGKESETVDSLLKLLRKHSVEQGKGKNSIGSSRDLSLDQPE
VNGSSNEDKGSRFFDSNDRVRSEAKEPYAPTLSRPASNFRRKSPVPQMKYQPIYSSEETV
NSVEHGNSDGKRNLSSAKSSPAPDHVPELEEDSESETEPGLEPESIYQDPDALDEFSEDE
SSDIDEEDREQQIGHEDLSALKLPELRALAKSRGLKGFSKMKKANLVELLSSSSF
Download sequence
Identical sequences Tc00_g030910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]