SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc00_g053380 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Tc00_g053380
Domain Number - Region: 43-89
Classification Level Classification E-value
Superfamily TSP9-like 0.034
Family TSP9-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc00_g053380
Sequence length 99
Comment Hypothetical protein
Sequence
MAKYDTWTNGMVTCVKFISIYFFWLKNQHKISPFLFIWPAKVRTKEEKKKTNPRWKNSRK
KCENSSNQAVKGGEHSGKSTEIVPEDQESEYLEFDSRNR
Download sequence
Identical sequences Tc00_g053380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]