SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc00_g055430 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc00_g055430
Domain Number 1 Region: 119-234
Classification Level Classification E-value
Superfamily POZ domain 1e-21
Family BTB/POZ domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc00_g055430
Sequence length 270
Comment Predicted protein (Fragment)
Sequence
MSGFPFERPSPTPLFGFSSNGTTSASGFSSPFGSFASTPANAGPSTFSFSPVGVNSGNHA
SSNAASATSTFGAATARRSPSGRTNSTAPTSKNEPHANVNKAMSGLKDTEDDLKKKISFL
SGFVVAFKEQTHTDILLKPNNGPCIPAHKALLAARSEIFKNMLDSDGCKAPPSDTDTITL
SELNNEELESLLEFLYTGNLPLDKLEKHVYSLYVAADKYEIPYLQESCESYMLNSLNASN
AIDILEIADAQSNKTLKETTLNFIIRNMXX
Download sequence
Identical sequences Tc00_g055430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]