SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc00_g062800 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc00_g062800
Domain Number 1 Region: 87-161
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.35e-21
Family Skp1 dimerisation domain-like 0.0002
Further Details:      
 
Domain Number 2 Region: 9-70
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000445
Family BTB/POZ domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc00_g062800
Sequence length 170
Comment Putative SKP1-like protein 4
Sequence
MSMAAVETKKITLRTADNHEFEVEEAIAMEFSTIKTFFDENPDASEDTIPLPNVTSKCLS
AIIEYCKSHLAFRARETSSSIDEQVRTYDEEFVKARDNESLKELILAANYLNIKALLDML
NQAVADRIKNKSVEYVRRFFGLENDYTPEEEAAIRAENEWAFEGVDPDDD
Download sequence
Identical sequences Tc00_g062800 XP_007022621.2.67643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]