SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc01_g004010 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc01_g004010
Domain Number 1 Region: 11-51,86-156
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000463
Family BTB/POZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc01_g004010
Sequence length 679
Comment Putative BTB/POZ domain-containing protein At1g30440
Sequence
MAADKPSSKGQAWFCATGLPSDIMIEVDDMTFHLHKFPLMSKSRKLDQLIAEQGRKSSTT
TVTKQRQRETETEIEEEEGEYQEEQENEEEEDQYQISLPDFPGGSETFEGAAKFCYGVKI
DLSSSTVVPLRCAAEFLEMTEEYSEGNLISKTERFLSQSVFKSLKESVKALKSCESVMSL
AESLGIVQRLIESIAARASSTDPTLFGWPVNDGIVEAKGASSQALWNGIETGLRRKSLGR
TNNVESWFEDLALLSLPLFKRLILTLKTRDLSPEIIESCLMCYAKKYIPGTSRSNRKPST
SSSASGVSEGEQRELLETIISNLPLEKSPTRSSTATRFLFGLLRTANILNASESCKAALE
KKIGFQLEQATLDDLLIPSYSYLNETLYDVDCIERILGYFLDGLEERNAEGIEAETRGNN
NNILNNNSVRPPALMLVGKLIDGYLSEIASDANLKPEKFYNLAISLPDQARLFDDGLYRA
VDVYLKAHPWIPESEREKICGVLDCQKLTLEACTHAAQNERLPLRAVVQVLFFEQLQLRH
AIAGTLLAAEAAPTNAGRLSEAMREEEDEEEEERAGVVSVSRGEEGSSTWRAAVRENQVL
RLDMDSMRTRVHQLERECSTMKKVIEKIEKEGPRGGGWRGSLNRRFGCKFRTQVCDSHES
TVAETRRGRHQSHHHHHEQ
Download sequence
Identical sequences XP_017983429.1.67643 Tc01_g004010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]