SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc01_g006260 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc01_g006260
Domain Number 1 Region: 27-127
Classification Level Classification E-value
Superfamily POZ domain 1.88e-17
Family BTB/POZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc01_g006260
Sequence length 623
Comment Putative BTB/POZ domain-containing protein At5g48800
Sequence
MVDLDQEETAPSSLNMSSKKKELLSTAMKRTSEWIFSQEIPSDVTVQVGGASFSLHKFPL
VSKCGFIRKVVSESNDADVSVIEIPDVPGGADSFELAAKFCYGINFEISTENIAMLRCAA
EYLEMTEDYAVGNLVGRTEAYLNEVALKSLAGAVSVLHTSENLLPLAEKVKLVSRCIDAI
AYLACKESQFCMSGRSESGNESAISSTISNSKPIVDWWAEDLAVLRIDIFQRVLVAMIAR
GFKQYALGPVLMLYAQKALRGLEIFGKGRKKIEPRQEHEKRVVLETIVSLLPREKNAMSV
SFLSVLLRAAIYLETTVACRLDLEKRMALQLGQAVLDDLLIPSYSFTGDTLFDVDTVQRI
MMNYLEYETEGTHFGYKEEDEYISPPPSDMERVGKLMESYLAEIASDRNLSVSKFIGLAE
LIPEQSRVTEDGMYRAIDIYLKAHPTISDLERKKVCSLMDCQKLSREACAHAAQNDRLPV
QTVVQVLYYEQQRLRDVMNGSISSGDSPAISSRVNLYTADIHPVSDELSSLKRENEDLKL
ELVKMKMRLKEIEKSSSVKSAVSSPMGIILPSSDKPPLPRKSFMNSVSKKLGRLYPFVRS
DGVSPSSAKGRTRPSKDRRHSIS
Download sequence
Identical sequences XP_017969321.1.67643 Tc01_g006260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]