SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc01_g006380 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc01_g006380
Domain Number 1 Region: 41-136
Classification Level Classification E-value
Superfamily POZ domain 4.08e-16
Family BTB/POZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc01_g006380
Sequence length 641
Comment Putative Coleoptile phototropism protein 1
Sequence
MVKFGVLEREERFQSSFSKMKFMKLGSKPDSFQTDGDNIRYVATELATDLVVNIGDLKFY
LHKFPLLSKSARLQKLVATSSDENSDEIHIQDIPGGPAAFEICAKFCYGMTVTLNAYNVV
AARCAAEYLEMYETVEKGNLIYKIDVFLNSSIFRSWKDSIIVLQTTKSLLPWSEEIKVVS
HCLDSIASKASIDTSKVEWSYTYNRKKLPSENGNSPQWNGVRKPQMVPKDWWVEDLCELH
IDLYKRVITTIKTKSRVSGDVIGEALNAYALRRLPGFSKGMVQNNDFIKYRSLVETIVRL
LPTERGTVSCSFLLRLLRAAILLDCGEMERNELMRRIGQQLPEATVTDLLIRAPAGEATI
YDVDIVHNLVEEFVTHSSQIDPTDNEFQKSRSPKFGPDACKVLVAKLIDGYLAEIARDPN
LHLSKFVYLAEIVASFSRPSHDGLYRAIDMYLKEHPGISKSEKKRICRLMDCRKLSAEAC
MHAVQNERLPLRVVVQVLFFEQVRATASAGNSTPDLPGSIRALLPGGSHGSSRSTTTNNE
EDWDSVPTAEDIKALKGELATLRLGSSGTDRNGNDAAKSDAEKIAANRMKGLVMSKIFSK
LWSSKERHGEISSSDTSESPGSVNAEETKSTPSRSRRHSLS
Download sequence
Identical sequences Tc01_g006380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]