SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc01_g006440 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc01_g006440
Domain Number 1 Region: 241-342
Classification Level Classification E-value
Superfamily TAZ domain 3.79e-24
Family TAZ domain 0.00046
Further Details:      
 
Domain Number 2 Region: 45-162
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000133
Family BTB/POZ domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc01_g006440
Sequence length 378
Comment Putative uncharacterized protein (Fragment)
Sequence
MSAKQPPQDANNICPAPPPLPGPATNCGRKGLFMMNGSQIRGYSCVSTATRDLWDSLFDG
GYRADIAIKTDYGGIVYAHSNILGMASPVLRGMLKQAKGFGKKRSITIHGVPQDAVRVFI
RFLYSSCYEKEEMKEYVLQLLVLSHAYVVPQLKQICEQHLEHGLLTIENVIDVLQLALLC
DAPRLSLISHRMILSNFKSVSATEGWKAMKKSHPALEKELLESVIDEENMRKNKIRKSNE
RKIYLQLYEAMEALVHICRDGCRTIGPHDKDFKEDQAPCNYAACKGLELLIRHFAGCKLR
VPGGCVHCKRMWQLLELHSRLCADSSLCRVPLCRNFKEKIRKQSKKDEIKWKMLVKKILR
TKRIGGAPFFVSLNSISS
Download sequence
Identical sequences Tc01_g006440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]