SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc01_g006500 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc01_g006500
Domain Number 1 Region: 3-87
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000165
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc01_g006500
Sequence length 426
Comment Protein binding protein, putative
Sequence
MGRKTDVLIHVHGTAFHLHKDPLSSRSTYLRRQLTEQSELTLSRPLNITAETFSLVAEFC
YGTHLLVTPFNVASLLLASELLGMTETKGDGDQNLKQITEGYFRRFVAVNGEYAAIVFRS
CLALLPEAETTAFLVSRCVEVMNSSDDGDGVDVYFDDVVSLHAEDFKIVAESMHQRFEYH
DLLYRIVDFYLEEHNGKITEEQKTQICNSIDCNKLSPQLLLHAVQNPRMPLRFVVRAMLV
EQLNTRRSIFSAANHYSSRPHRPARDNITLGAILQRDATMRETAQLKAAMDATSSRIQTL
EKQLHCMKKILQDSDHNGGVGAGSRDVLGSGRSASFHYGSGNTIERADRGASSSASFRFS
RPEDKAFGSSSSENSCVDSPRIKKNIGQRLIEGLKSALRVPNSSTKNGSAKKISSKGENG
TLYFNQ
Download sequence
Identical sequences Tc01_g006500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]